DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and HAB1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001185385.1 Gene:HAB1 / 843609 AraportID:AT1G72770 Length:511 Species:Arabidopsis thaliana


Alignment Length:330 Identity:93/330 - (28%)
Similarity:142/330 - (43%) Gaps:70/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PLHTSAAVKNKPRKMED-------------RCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSAT 209
            ||..:.:::....:|||             :.:..|..|....|...|..||||:|||.|...|.
plant   188 PLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPSLTHLTGHFFGVYDGHGGHKVAD 252

  Fly   210 YATSQLPQLLADQLKANPDPAAFSPDFYRN-----------AFESAFLLADERFTQK-------- 255
            |...:|...||::::...|...     .||           .|.|.||..|.....|        
plant   253 YCRDRLHFALAEEIERIKDELC-----KRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGS 312

  Fly   256 --KI-------TSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIET 311
              |:       |.|:|:|.||:....:.::..|||:|:|...:..:.|...|||:..||..|||.
plant   313 SDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIEN 377

  Fly   312 AGGTVLHAQGQWRVNGILNVARSIGD-YSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPES 375
            |||.|:..||. ||.|:|.::||||| |....||.||:...:..:...:.|:|.:|||||.:...
plant   378 AGGKVIQWQGA-RVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQ 441

  Fly   376 LIIETV------------YDSLADTTMKLD-------DIPKLLIEAAKERDSQDNITAVVVLLKP 421
            .:.|..            ...||:....:|       |...:|   |.::.|:|||:.:|:.||.
plant   442 EVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSML---ALQKGSKDNISIIVIDLKA 503

  Fly   422 RHQIE 426
            :.:.:
plant   504 QRKFK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 89/319 (28%)
HAB1NP_001185385.1 PP2Cc 180..499 CDD:214625 90/319 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.