DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT1G48040

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_175238.2 Gene:AT1G48040 / 841222 AraportID:AT1G48040 Length:383 Species:Arabidopsis thaliana


Alignment Length:266 Identity:80/266 - (30%)
Similarity:122/266 - (45%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 MEDRCVCLDRFGE---MYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPA--- 230
            |||..:|:|....   .|. ....:.|:||||||.|..:|.:....|.:|..........|:   
plant    91 MEDEHICIDDLSAHLGSYN-FSVPSAFYGVFDGHGGPEAAIFMKENLTRLFFQDAVFPEMPSIVD 154

  Fly   231 AFSPDFYRNAFESAFLLADERFTQKKITS---GTTSVCALITKDQLYIAWVGDSKALLVGKRTQL 292
            ||..:...|:...||.|||.....:.|.|   |||::.|||....|.:|..||.:|:|..:...:
plant   155 AFFLEELENSHRKAFALADLAMADETIVSGSCGTTALTALIIGRHLLVANAGDCRAVLCRRGVAV 219

  Fly   293 QLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLE--------AVIAEPDF 349
            .:...|:.....||:|||..||  ....|.  :||:|.|.|:|||:.|:        .:|::|:.
plant   220 DMSFDHRSTYEPERRRIEDLGG--YFEDGY--LNGVLAVTRAIGDWELKNPFTDSSSPLISDPEI 280

  Fly   350 VDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKER---DSQDN 411
            ..:.|.|..:||:|..||:||.:.....:..|...|    .:..|..:..:|..||.   .|.||
plant   281 GQIILTEDDEFLILACDGIWDVLSSQNAVSNVRQGL----RRHGDPRQCAMELGKEAARLQSSDN 341

  Fly   412 ITAVVV 417
            :|.:|:
plant   342 MTVIVI 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 80/266 (30%)
AT1G48040NP_175238.2 PP2Cc 77..349 CDD:238083 80/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.