DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT1G47380

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_564504.1 Gene:AT1G47380 / 841141 AraportID:AT1G47380 Length:428 Species:Arabidopsis thaliana


Alignment Length:284 Identity:79/284 - (27%)
Similarity:127/284 - (44%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NKPRKMED----RCVCLDRFGEMYELLDKTTRF--FGVFDGHSGSLSATYATSQLPQLLADQLKA 225
            |:.:|.||    :..|....|      |..|.|  ||:||||:||.:|.|....|         .
plant    36 NQSKKGEDFTLVKTECQRVMG------DGVTTFSVFGLFDGHNGSAAAIYTKENL---------L 85

  Fly   226 NPDPAAFSPDFYRN--------AFESAFLLADERFTQKKITSGTTSVCALITKDQLYIAWVGDSK 282
            |...||...|..|:        |..:.|:..|:.|.::..|||||....::....:.:|.||||:
plant    86 NNVLAAIPSDLNRDEWVAALPRALVAGFVKTDKDFQERARTSGTTVTFVIVEGWVVSVASVGDSR 150

  Fly   283 ALL-VGKRTQLQLVKPHKPE-NPDERKRIETAGGTV--LHAQGQWRVN------GILNVARSIGD 337
            .:| ..:.....|...|:.| |.:||.|:..:||.|  |:..|...:.      |.|.::|||||
plant   151 CILEPAEGGVYYLSADHRLEINEEERDRVTASGGEVGRLNTGGGTEIGPLRCWPGGLCLSRSIGD 215

  Fly   338 YSL-EAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVY----DSLADTTMKLDDIPK 397
            ..: |.::..|....|:|:.|...|::.:||:||.:.....::...    :|.|:..:|      
plant   216 LDVGEYIVPVPYVKQVKLSSAGGRLIISSDGVWDAISAEEALDCCRGLPPESSAEHIVK------ 274

  Fly   398 LLIEAAKERDSQDNITAVVVLLKP 421
               ||..::..:|:.|.:||.:.|
plant   275 ---EAVGKKGIRDDTTCIVVDILP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 78/280 (28%)
AT1G47380NP_564504.1 PP2Cc 39..293 CDD:238083 77/277 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.