DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT1G34750

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001321553.1 Gene:AT1G34750 / 840379 AraportID:AT1G34750 Length:282 Species:Arabidopsis thaliana


Alignment Length:243 Identity:75/243 - (30%)
Similarity:118/243 - (48%) Gaps:45/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 FGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQKKITS- 259
            |.::|||.|.....|....|...:..:.:...||            :.:.:.|.|: |.:.|.| 
plant    67 FAIYDGHLGERVPAYLQKHLFSNILKEEQFRYDP------------QRSIIAAYEK-TDQAILSH 118

  Fly   260 -------GTTSVCALITKD-QLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTV 316
                   |:|:|.|::... :|::|.||||:|:|......:|:...|:|..  ||..||..||.|
plant   119 SSDLGRGGSTAVTAILMNGRRLWVANVGDSRAVLSQGGQAIQMTIDHEPHT--ERLSIEGKGGFV 181

  Fly   317 LHAQGQW-RVNGILNVARSIGDYSLEAVI-AEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIE 379
            .:..|.. ||||.|.|:|:.||.||:..: ::||..|..:::..|.|||.:||||..:.....| 
plant   182 SNMPGDVPRVNGQLAVSRAFGDKSLKTHLRSDPDVKDSSIDDHTDVLVLASDGLWKVMANQEAI- 245

  Fly   380 TVYDSLADTTMKLDDIPKLLIEAAKE-------RDSQDNITAVVVLLK 420
                   |...::.| |   ::||||       |||:|:|:.:||.|:
plant   246 -------DIARRIKD-P---LKAAKELTTEALRRDSKDDISCIVVRLR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 74/240 (31%)
AT1G34750NP_001321553.1 PP2Cc 33..281 CDD:238083 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.