DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT1G03590

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_171856.4 Gene:AT1G03590 / 839447 AraportID:AT1G03590 Length:462 Species:Arabidopsis thaliana


Alignment Length:292 Identity:75/292 - (25%)
Similarity:119/292 - (40%) Gaps:67/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 ELLDKTTRFFGVFDGHS--GSLSATYATSQLPQLL---------------------ADQLKANPD 228
            :.:.|...|.||||||.  |.|.|......||..|                     :|.|:|..:
plant    82 DFMSKDVTFCGVFDGHGPHGHLVARKVRDSLPVKLLSLLNSIKSKQNGPIGTRASKSDSLEAEKE 146

  Fly   229 PAAFSPD---FYRNAFESAFLLADERFTQ----KKITSGTTSVCALITKDQLYIAWVGDSKALLV 286
            .:.....   .:..||..:|...|:....    :...||.|:|..:.....||:..:|||:|:|.
plant   147 ESTEEDKLNFLWEEAFLKSFNAMDKELRSHPNLECFCSGCTAVTIIKQGSNLYMGNIGDSRAILG 211

  Fly   287 GKRTQ-----LQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGI---------LNVARSIGD 337
            .|.:.     :||....||:.|.|.:||:...|.|...|.:..|:.:         |.:||:.||
plant   212 SKDSNDSMIAVQLTVDLKPDLPREAERIKQCKGRVFALQDEPEVSRVWLPFDNAPGLAMARAFGD 276

  Fly   338 YSLE--AVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIET-------------VYDS--- 384
            :.|:  .||:.|:|....|.:...|:||.:||:||.:....::|.             |.||   
plant   277 FCLKDYGVISIPEFSHRVLTDRDQFIVLASDGVWDVLSNEEVVEVVASATSRASAARLVVDSAVR 341

  Fly   385 ---LADTTMKLDD--IPKLLIEAAKERDSQDN 411
               |...|.|:||  :..|.::...:.::.||
plant   342 EWKLKYPTSKMDDCAVVCLFLDGRMDSETSDN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 75/292 (26%)
AT1G03590NP_171856.4 PP2Cc 59..362 CDD:238083 73/279 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.