DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PAPP2C

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001185062.1 Gene:PAPP2C / 838835 AraportID:AT1G22280 Length:287 Species:Arabidopsis thaliana


Alignment Length:266 Identity:78/266 - (29%)
Similarity:115/266 - (43%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VKNKP-RKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANP- 227
            ||.|. ..|||..|     .....:.|.....|.::|||.|.....|...:|...:..::|... 
plant    39 VKGKANHPMEDYHV-----ANFINIQDHELGLFAIYDGHMGDSVPAYLQKRLFSNILKEVKTKKK 98

  Fly   228 -----DPAAFSPDFYRNAFESAFLLADERFTQKKI---TSGTTSVCA-LITKDQLYIAWVGDSKA 283
                 ||        |.:...|:...|:.......   ..|:|:|.| ||...:|:||.||||:|
plant    99 GEFWVDP--------RRSIAKAYEKTDQAILSNSSDLGRGGSTAVTAILINGRKLWIANVGDSRA 155

  Fly   284 LLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQW-RVNGILNVARSIGDYSLEA-VIAE 346
            :|.......|:...|:|..  ||..||..||.|.:..|.. ||||.|.|:|:.||..|:. :.:|
plant   156 VLSHGGAITQMSTDHEPRT--ERSSIEDRGGFVSNLPGDVPRVNGQLAVSRAFGDKGLKTHLSSE 218

  Fly   347 PDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDN 411
            ||..:..::...|.|:|.:||:|..:.....:|     :|..........|.|...|..|:|:|:
plant   219 PDIKEATVDSQTDVLLLASDGIWKVMTNEEAME-----IARRVKDPQKAAKELTAEALRRESKDD 278

  Fly   412 ITAVVV 417
            |:.|||
plant   279 ISCVVV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 78/266 (29%)
PAPP2CNP_001185062.1 PP2Cc 32..286 CDD:238083 78/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.