DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT1G18030

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_564045.1 Gene:AT1G18030 / 838383 AraportID:AT1G18030 Length:351 Species:Arabidopsis thaliana


Alignment Length:428 Identity:108/428 - (25%)
Similarity:173/428 - (40%) Gaps:142/428 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SEEVVSRSCVTRTANETYKVSGEERHAELVSAIWKQLETRGCPAQFRIKLLHRSTQQLEQDLCFA 96
            ||::||   ..:.|.::.:|||   ..|.|:|:                    ..::.|:|    
plant    25 SEDLVS---PVKKAKKSEEVSG---GGEAVAAV--------------------GNREAEED---- 59

  Fly    97 KECEVTVEGPPQYDLLKLQKFVASEFEKYILKLTDNSEVDRLKDFADEAAPENCECHQQKEPLHT 161
                             ...||:.|.::::::             ||.|        :.|...||
plant    60 -----------------KPSFVSEEKKEFLVE-------------ADVA--------EDKGARHT 86

  Fly   162 SAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRF--------FGVFDGHSGSLSATYA------- 211
                      |||..|.|.         |.:..|        |.::|||.|.|:|.:|       
plant    87 ----------MEDVWVVLP---------DASLDFPGTLRCAHFAIYDGHGGRLAAEFAKKHLHLN 132

  Fly   212 --TSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQKKIT----SGTTSVCALITK 270
              ::.||:.|.|...|            :.|....|...||...||.::    .|.|:||..|..
plant   133 VLSAGLPRELLDVKVA------------KKAILEGFRKTDELLLQKSVSGGWQDGATAVCVWILD 185

  Fly   271 DQLYIAWVGDSKALL--------VGKRTQ-------LQLVKPHKPENPDERKRIETAGGTVLHAQ 320
            .::::|.:||:||:|        :|..|:       :.|.:.||...|.||.||:.:|| |:.:.
plant   186 QKVFVANIGDAKAVLARSSTTNELGNHTEAGNPLKAIVLTREHKAIYPQERSRIQKSGG-VISSN 249

  Fly   321 GQWRVNGILNVARSIGD--YSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYD 383
            |  |:.|.|.|:|:.||  :....|.|.||....:|.|..:|::||.||||:....|..:..| .
plant   250 G--RLQGRLEVSRAFGDRHFKKFGVSATPDIHAFELTERENFMILGCDGLWEVFGPSDAVGFV-Q 311

  Fly   384 SLADTTMKLDDIPKLLI-EAAKERDSQDNITAVVVLLK 420
            .|....:.:..:.:.|: ||.|||..:||.||:|::.|
plant   312 KLLKEGLHVSTVSRRLVKEAVKERRCKDNCTAIVIVFK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 87/297 (29%)
AT1G18030NP_564045.1 PP2Cc 77..348 CDD:238083 89/313 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.