DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT1G07160

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_172196.1 Gene:AT1G07160 / 837227 AraportID:AT1G07160 Length:380 Species:Arabidopsis thaliana


Alignment Length:297 Identity:89/297 - (29%)
Similarity:139/297 - (46%) Gaps:39/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PLHTSAAVKN--KPRKMEDRCV----------CL--------DRFGEMYELL-DKTTRFFGVFDG 201
            |:..:|.:.|  .||: |.|.|          |.        |||..:..|. |.....|||:||
plant    96 PVGIAAPISNADTPRE-ESRAVEREGDGYSVYCKRGKREAMEDRFSAITNLQGDPKQAIFGVYDG 159

  Fly   202 HSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERF-TQKKITSGTTSVC 265
            |.|..:|.:|...|...:..::....:.:..     ..|.:..:|..|..| .:|.:..|:..|.
plant   160 HGGPTAAEFAAKNLCSNILGEIVGGRNESKI-----EEAVKRGYLATDSEFLKEKNVKGGSCCVT 219

  Fly   266 ALITKDQLYIAWVGDSKALL-VGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGIL 329
            |||:...|.:|..||.:|:| ||...: .|...|:|...|||.|||::||.|......||:.|.|
plant   220 ALISDGNLVVANAGDCRAVLSVGGFAE-ALTSDHRPSRDDERNRIESSGGYVDTFNSVWRIQGSL 283

  Fly   330 NVARSIGDYSLEA-VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLD 393
            .|:|.|||..|:. :|:||:...:::|..|:||:|.:|||||.|.....::........|..|..
plant   284 AVSRGIGDAHLKQWIISEPEINILRINPQHEFLILASDGLWDKVSNQEAVDIARPFCKGTDQKRK 348

  Fly   394 DI--PKLLIEAAKERDSQDNITAVVVLLKPRHQIEHL 428
            .:  .|.|::.:..|.|.|:|:.:::      |:.||
plant   349 PLLACKKLVDLSVSRGSLDDISVMLI------QLCHL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 85/284 (30%)
AT1G07160NP_172196.1 PP2Cc 122..376 CDD:238083 78/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.