DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and HAI1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_200730.1 Gene:HAI1 / 836040 AraportID:AT5G59220 Length:413 Species:Arabidopsis thaliana


Alignment Length:303 Identity:90/303 - (29%)
Similarity:138/303 - (45%) Gaps:42/303 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFF--GVFDGHSGSLSATYATSQLPQLLA 220
            |.:..|:|..:.|:||| .|.:..|...::....:|.|.  ||:|||..|..|.....:|.:|:.
plant   110 PKYGVASVCGRRREMED-AVAVHPFFSRHQTEYSSTGFHYCGVYDGHGCSHVAMKCRERLHELVR 173

  Fly   221 DQLKANPD-PAAFSPDFYRNAFESAFLLAD-------ERFTQKKITSGTTSVCALITKDQLYIAW 277
            ::.:|:.| ..:.:..|.|...|...|.||       |.........|:|:|.:::|.:::.:|.
plant   174 EEFEADADWEKSMARSFTRMDMEVVALNADGAAKCRCELQRPDCDAVGSTAVVSVLTPEKIIVAN 238

  Fly   278 VGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGD-YSLE 341
            .|||:|:|......:.|...|||:.|||..||:.|||.|::..|. ||.|:|.::|:||| |...
plant   239 CGDSRAVLCRNGKAIALSSDHKPDRPDELDRIQAAGGRVIYWDGP-RVLGVLAMSRAIGDNYLKP 302

  Fly   342 AVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSL--------------------- 385
            .||:.|:..........|||:|.:|||||.|........|...|                     
plant   303 YVISRPEVTVTDRANGDDFLILASDGLWDVVSNETACSVVRMCLRGKVNGQVSSSPEREMTGVGA 367

  Fly   386 ADTTMKLDDIPK--------LLIEAAKERDSQDNITAVVVLLK 420
            .:..:...|:|.        ||...|..|.|.||::.|||.|:
plant   368 GNVVVGGGDLPDKACEEASLLLTRLALARQSSDNVSVVVVDLR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 88/298 (30%)
HAI1NP_200730.1 PP2Cc 112..347 CDD:214625 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.