DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ABI2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_200515.1 Gene:ABI2 / 835809 AraportID:AT5G57050 Length:423 Species:Arabidopsis thaliana


Alignment Length:368 Identity:99/368 - (26%)
Similarity:165/368 - (44%) Gaps:82/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VEGPPQYDLLKLQKFVASEFEKYILKLTDNSEVDRLKDFADEAAPENCECHQQKEPLHTSAAVKN 167
            :.|..::|...:     ::.||.:|..|::..:...|            |    .||:...::..
plant    77 INGSDEFDPRSM-----NQSEKKVLSRTESRSLFEFK------------C----VPLYGVTSICG 120

  Fly   168 KPRKMEDRCVCLDRFGEM--YELLD----------KTTRFFGVFDGHSGSLSATYATSQLPQLLA 220
            :..:|||....:.||.::  ..|||          .:..||||:|||.||..|.|...::...|.
plant   121 RRPEMEDSVSTIPRFLQVSSSSLLDGRVTNGFNPHLSAHFFGVYDGHGGSQVANYCRERMHLALT 185

  Fly   221 DQLKANPDPAAFSPDF---------YRNAFESAFLLAD---ERFTQKKITSGTTSVCALITKDQL 273
            :::...      .|:|         ::.|..::|:..|   |.......|.|:|||.|::....:
plant   186 EEIVKE------KPEFCDGDTWQEKWKKALFNSFMRVDSEIETVAHAPETVGSTSVVAVVFPTHI 244

  Fly   274 YIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGD- 337
            ::|..|||:|:|...:|.|.|...|||:..||..|||.|||.|:...|. ||.|:|.::||||| 
plant   245 FVANCGDSRAVLCRGKTPLALSVDHKPDRDDEAARIEAAGGKVIRWNGA-RVFGVLAMSRSIGDR 308

  Fly   338 YSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETV---------YDSLADTTMKLD 393
            |...:||.:|:...|:..:..|.|:|.:|||||.:....:.:..         .:::|...:   
plant   309 YLKPSVIPDPEVTSVRRVKEDDCLILASDGLWDVMTNEEVCDLARKRILLWHKKNAMAGEAL--- 370

  Fly   394 DIP----------------KLLIEAAKERDSQDNITAVVVLLK 420
             :|                :.|.:.|.::.|:|||:.|||.||
plant   371 -LPAEKRGEGKDPAAMSAAEYLSKMALQKGSKDNISVVVVDLK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 87/308 (28%)
ABI2NP_200515.1 PP2Cc 103..409 CDD:214625 89/332 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.