DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT5G53140

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001329972.1 Gene:AT5G53140 / 835395 AraportID:AT5G53140 Length:420 Species:Arabidopsis thaliana


Alignment Length:265 Identity:91/265 - (34%)
Similarity:137/265 - (51%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQL-------PQLLAD-QLK 224
            |...:|.:.||:                ||:||||.||.:|.|....|       ||.|.| :|.
plant   121 KASTIEGQAVCM----------------FGIFDGHGGSRAAEYLKEHLFNNLMKHPQFLTDTKLA 169

  Fly   225 ANPDPAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALITKDQLYIAWVGDSKALLVGKR 289
            .|        :.|:.. :.|| |..|:.|.:  ..|:|:..|::..:.||:|.||||:.::....
plant   170 LN--------ETYKQT-DVAF-LESEKDTYR--DDGSTASAAVLVGNHLYVANVGDSRTIVSKAG 222

  Fly   290 TQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL-EAVIAEPDFVDVQ 353
            ..:.|...|||...|||||||:|||.::.| |.|||.|:|.::|:.|:..| :.|:|||:..|::
plant   223 KAIALSDDHKPNRSDERKRIESAGGVIMWA-GTWRVGGVLAMSRAFGNRMLKQFVVAEPEIQDLE 286

  Fly   354 LNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITAVVVL 418
            ::...:.|||.:|||||.||....:     :||.:..:.:...:.|.:.|..|.|.||||.:|| 
plant   287 IDHEAELLVLASDGLWDVVPNEDAV-----ALAQSEEEPEAAARKLTDTAFSRGSADNITCIVV- 345

  Fly   419 LKPRH 423
             |.||
plant   346 -KFRH 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 88/259 (34%)
AT5G53140NP_001329972.1 PP2Cc 101..347 CDD:238083 88/261 (34%)
NESP55 312..>412 CDD:115071 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 1 1.000 - - FOG0002007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.