DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AHG1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_199989.1 Gene:AHG1 / 835250 AraportID:AT5G51760 Length:416 Species:Arabidopsis thaliana


Alignment Length:364 Identity:103/364 - (28%)
Similarity:158/364 - (43%) Gaps:58/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VASEFEKYILKLTDNSEVDRLK----DFADEAAPENCECHQ---------QKEPLHTSAAVKNKP 169
            |.|.|:..:.|....||:..|.    .|....|..:|:..:         :.|||:...:|..:.
plant    54 VYSSFDVPLRKQARRSEIGGLPADIGGFLAPPAASSCQKSEAPVWKGEETEDEPLYGIVSVMGRS 118

  Fly   170 RKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSP 234
            |||||.........:......:...||.|:|||.||..:|..::.:...:.::|:.|.:......
plant   119 RKMEDSVTVKPNLCKPEVNRQRPVHFFAVYDGHGGSQVSTLCSTTMHTFVKEELEQNLEEEEEGS 183

  Fly   235 D------FYRNAFESAFLLADERFT----------------QKKITSGTTSVCALITKDQLYIAW 277
            :      .:|...:.:|...||..|                ::...||:|:|.|::|.|.:.:|.
plant   184 ENDVVERKWRGVMKRSFKRMDEMATSTCVCGTSVPLCNCDPREAAISGSTAVTAVLTHDHIIVAN 248

  Fly   278 VGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEA 342
            .|||:|:|......:.|...|||:.||||.|||.|||.||...|. ||.|||..:|:|||..|:.
plant   249 TGDSRAVLCRNGMAIPLSNDHKPDRPDERARIEAAGGRVLVVDGA-RVEGILATSRAIGDRYLKP 312

  Fly   343 VIA-EPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPK--------- 397
            ::| ||:...::.....:.|||.:|||||.:...|..:.....|.:.|....|:.:         
plant   313 MVAWEPEVTFMRRESGDECLVLASDGLWDVLSSQLACDIARFCLREETPSSLDLNRMAQEDDNDG 377

  Fly   398 ------------LLIEAAKERDSQDNITAVVVLLKPRHQ 424
                        ||...|..|.|.|||:.||:.||...|
plant   378 EQNPSRSVLAATLLTRLALGRQSSDNISVVVIDLKNSSQ 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 87/302 (29%)
AHG1NP_199989.1 PP2Cc 109..411 CDD:238083 87/302 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.