DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT5G27930

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_568503.1 Gene:AT5G27930 / 832860 AraportID:AT5G27930 Length:373 Species:Arabidopsis thaliana


Alignment Length:354 Identity:84/354 - (23%)
Similarity:149/354 - (42%) Gaps:76/354 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ILKLTDNSEVDRLKDFADEAAPENCECHQQKEPLHTSAAVKN---------------KPRKMEDR 175
            |.|:.:|:.....|:.|||.|.|    .::||.:..|:...|               :....:|.
plant    17 IKKVKNNNGNCDAKEAADEMASE----AKKKELILKSSGYVNVQGSNNLASLFSKRGEKGVNQDC 77

  Fly   176 CVCLDRFGEMYELLDKTTRFFGVFDGHS--GSLSATYATSQLP--------QLLA--------DQ 222
            .:..:.||...:::     |.|:||||.  |...|....:.:|        ::||        |.
plant    78 ALVWEGFGCQEDMI-----FCGIFDGHGPWGHYVAKQVRNSMPLSLLCNWQKILAQATLEPELDL 137

  Fly   223 LKANPDPAAFSPDFYRNAFESAFLLADERFT-QKKIT---SGTTSVCALITKDQLYIAWVGDSKA 283
            ..:|...:.|  |.::.::.......|:... .:||.   ||||::..:...:.:|:|.||||:|
plant   138 EGSNKKISRF--DIWKQSYLKTCATVDQELEHHRKIDSYYSGTTALTIVRQGEVIYVANVGDSRA 200

  Fly   284 LLV-----GKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGI---------LNVARS 334
            :|.     |....:||....||..|.|::||....|.|.....:..|:.:         |.::|:
plant   201 VLAMESDEGSLVAVQLTLDFKPNLPQEKERIIGCKGRVFCLDDEPGVHRVWQPDAETPGLAMSRA 265

  Fly   335 IGDYSLE--AVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPK 397
            .|||.::  .:::.|:.....::....|::|.:||:||.:.....||.|     .:|.:.....|
plant   266 FGDYCIKEYGLVSVPEVTQRHISTKDHFIILASDGIWDVISNQEAIEIV-----SSTAERPKAAK 325

  Fly   398 LLIEAA------KERD-SQDNITAVVVLL 419
            .|:|.|      |.|. |.|:::.|.:.|
plant   326 RLVEQAVRAWKKKRRGYSMDDMSVVCLFL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 72/318 (23%)
AT5G27930NP_568503.1 PP2Cc 62..353 CDD:238083 70/302 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.