DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT5G26010

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_197973.2 Gene:AT5G26010 / 832670 AraportID:AT5G26010 Length:331 Species:Arabidopsis thaliana


Alignment Length:337 Identity:88/337 - (26%)
Similarity:144/337 - (42%) Gaps:58/337 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 TDNSEVDRLKDFADEAAPENCECH------QQKEPLH---TSAAVKNKPRKMEDRCVCLDRFGEM 185
            :..||:....:..|    .|..|:      .|..|:|   :..:::......:|..|....:|  
plant     9 SSQSEIHEDNEHGD----GNVVCYGEEFGLDQDLPVHRLGSVCSIQGTKVLNQDHAVLYQGYG-- 67

  Fly   186 YELLDKTTRFFGVFDGH--SGSLSATYATSQLPQL---LADQLKANPDPAAFSPDFYRNAFESAF 245
                .:.|...||||||  :|.:.:....::||.:   |.::|....:........:..|..:||
plant    68 ----TRDTELCGVFDGHGKNGHMVSKMVRNRLPSVLLALKEELNQESNVCEEEASKWEKACFTAF 128

  Fly   246 LLADERFTQKKIT---SGTTSVCALITKDQLYIAWVGDSKALLVGKRTQ------LQLVKPHKPE 301
            .|.|.....:...   ||:|.|.|:...|.|.||.:|||:|:| |..|:      :||.....|:
plant   129 RLIDRELNLQVFNCSFSGSTGVVAITQGDDLVIANLGDSRAVL-GTMTEDGEIKAVQLTSDLTPD 192

  Fly   302 NPDERKRIETAGGTVL------HAQGQWRVN----GILNVARSIGDYSLE--AVIAEPDFVDVQL 354
            .|.|.:||....|.|.      .:|..|..|    | |.::|:.||:.|:  .|||.|:....::
plant   193 VPSEAERIRMCKGRVFAMKTEPSSQRVWLPNQNIPG-LAMSRAFGDFRLKDHGVIAVPEISQHRI 256

  Fly   355 NEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAA----KER---DSQDNI 412
            .....||||.|||:||.:....::..::.|    ..|.....|::.|||    |:|   ...|:|
plant   257 TSKDQFLVLATDGVWDMLSNDEVVSLIWSS----GKKQASAAKMVAEAAEAAWKKRLKYTKVDDI 317

  Fly   413 TAVVVLLKPRHQ 424
            |.:.:.|:.:.|
plant   318 TVICLFLQNKEQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 79/294 (27%)
AT5G26010NP_197973.2 PP2Cc 42..324 CDD:238083 78/293 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.