DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT5G24940

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_197876.1 Gene:AT5G24940 / 832564 AraportID:AT5G24940 Length:447 Species:Arabidopsis thaliana


Alignment Length:263 Identity:91/263 - (34%)
Similarity:140/263 - (53%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 AAVKNKPRKMED----RCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQL 223
            |:...|...|||    |...:|  ||:..|       |||||||.||.:|.|....|...|....
plant    37 ASSAGKRSSMEDFFETRIDGID--GEIVGL-------FGVFDGHGGSRAAEYVKRHLFSNLITHP 92

  Fly   224 KANPDPAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALITKDQLYIAWVGDSKALLVGK 288
            |...|..:...|.|.:. :|..|.::...|:   .:|:|:..|::..|:|.:|.||||:|::...
plant    93 KFISDTKSAIADAYTHT-DSELLKSENSHTR---DAGSTASTAILVGDRLLVANVGDSRAVICRG 153

  Fly   289 RTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL-EAVIAEPDFVDV 352
            .....:.:.|||:..|||:|||.|||.|:.| |.|||.|:|.|:|:.||..| :.|:|:|:..:.
plant   154 GNAFAVSRDHKPDQSDERERIENAGGFVMWA-GTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEE 217

  Fly   353 QLNEAHDFLVLGTDGLWD---HVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITA 414
            :::::.:||:|.:|||||   :.....:::.|.|.        ::..|.|:..|.:|.|.||||.
plant   218 KIDDSLEFLILASDGLWDVFSNEEAVAVVKEVEDP--------EESTKKLVGEAIKRGSADNITC 274

  Fly   415 VVV 417
            |||
plant   275 VVV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 91/263 (35%)
AT5G24940NP_197876.1 PP2Cc 32..279 CDD:238083 91/263 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.