DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and KAPP

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001154720.1 Gene:KAPP / 832048 AraportID:AT5G19280 Length:591 Species:Arabidopsis thaliana


Alignment Length:294 Identity:75/294 - (25%)
Similarity:120/294 - (40%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 AVKNKPRKMEDRCVC--------LDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLA 220
            |::...||:....||        .::||           .|.|.|||.||.:|..|...:|::||
plant   313 AMRRGGRKLPMEDVCHYKWPLPGANKFG-----------LFCVCDGHGGSGAAQSAIKIIPEVLA 366

  Fly   221 ----DQLKANPDPAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALITKDQ-----LYIA 276
                |.|:..   ...|.....:.....|...:.|..:.:. .|.|:...|:.||.     ...|
plant   367 NILSDSLRKE---KVLSKRDASDVLRDMFAKTEARLEEHQY-EGCTATVLLVWKDNEENFFAQCA 427

  Fly   277 WVGDSKALLVGK----------RTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNV 331
            .:|||..::..|          ...:|:.:.|:..:..||||.:.||  :....|:.|:.|| |:
plant   428 NLGDSACVIQNKDLACLKRDLGGRYIQMTEDHRVVSLSERKRFQEAG--LALRDGETRLFGI-NL 489

  Fly   332 ARSIGD---------YSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVY---DS 384
            ||.:||         :|.|..|:||..:|....:.  |.||.:|||||.|.....::.|.   |.
plant   490 ARMLGDKFPKQQDSRFSAEPYISEPLRIDQSSKDV--FAVLASDGLWDVVSPKKAVQLVLQMRDK 552

  Fly   385 LADTTMKLDDIPKLLIEAAKERDSQDNITAVVVL 418
            ........:.|...|:..|:...::|| |:::.|
plant   553 ERGRESSAEKIANGLLNEARAMRTKDN-TSIIYL 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 75/294 (26%)
KAPPNP_001154720.1 FHA 181..295 CDD:238017
FHA <211..296 CDD:224630
PP2C 309..580 CDD:278884 73/287 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.