DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT5G01700

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001031819.1 Gene:AT5G01700 / 831695 AraportID:AT5G01700 Length:382 Species:Arabidopsis thaliana


Alignment Length:306 Identity:76/306 - (24%)
Similarity:136/306 - (44%) Gaps:64/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 HTSAAVKNKPRKM-EDRCVCLDRFGEMYELLDKTTRFFGVFDGHS--GSLSATYATSQLPQLLAD 221
            |.|.::|...:.: :|.....:.||.     ::.|.|.||||||.  |...:.:....||..:..
plant    47 HVSMSIKQGKKGINQDAMTVWENFGG-----EEDTIFCGVFDGHGPMGHKISRHVCENLPSRVHS 106

  Fly   222 QLKANPDPAAFSPDFYRNAFESAFLLADERFTQ---------KKI-------------TSGTTSV 264
            :::::  .:|...:...|:.:|    .:|.|.:         |:|             .||||:|
plant   107 KIRSS--KSAGDENIENNSSQS----QEELFREFEDILVTFFKQIDSELGLDSPYDSFCSGTTAV 165

  Fly   265 CALITKDQLYIAWVGDSKALLVGKRTQ-----LQLVKPHKPENPDERKRIETAGGTVLHAQGQWR 324
            ......|.|.||.:|.|:|:| |.|::     :||....||....|.:||.:..|.|...:.:..
plant   166 TVFKQADCLVIANLGHSRAVL-GTRSKNSFKAVQLTVDLKPCVQREAERIVSCKGRVFAMEEEPD 229

  Fly   325 VNGI---------LNVARSIGDYSLE--AVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLII 378
            |..:         |.::|:.||:.|:  .::..||....:::...:|:||.|||:||.:....::
plant   230 VYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPDVFCRKVSREDEFVVLATDGIWDVLSNEEVV 294

  Fly   379 ETVYDSLADTTMKLDDIPKLLIEAA------KERDSQDNITAVVVL 418
            :.| .|..|.::..:    :|::.|      |...|:.:..|||||
plant   295 KVV-GSCKDRSVAAE----MLVQRAARTWRTKFPASKADDCAVVVL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 76/306 (25%)
AT5G01700NP_001031819.1 PP2Cc 47..337 CDD:238083 76/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.