DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PLL2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_195860.1 Gene:PLL2 / 830937 AraportID:AT5G02400 Length:674 Species:Arabidopsis thaliana


Alignment Length:421 Identity:84/421 - (19%)
Similarity:142/421 - (33%) Gaps:141/421 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GP--PQYDLLKLQKFVASEF------EKYILKLTDN--SEVDRLKDFAD-EAAPENCECHQQKEP 158
            ||  |.|.|..|...|..|.      ::.:..|.:|  ::..:..|..| |:..|||......:.
plant   286 GPDAPDYLLNNLYTAVQKELNGLLWNDEKLRSLGENGMTKTGKCSDEEDPESGKENCPVINNDDA 350

  Fly   159 LHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQL 223
            :.:.|  :|:.:.::.||       |..:..:..|:.....| ..||.|.|.....:.:.|...|
plant   351 VASGA--RNQAKSLKWRC-------EWEKKSNNKTKSDNRCD-QKGSNSTTTNHKDVLKALLQAL 405

  Fly   224 KANPDPAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALIT---KDQLYIAWVGDSKALL 285
            :..               |.|:|...::..::.........|.|:|   .:.:|:..||||:|:|
plant   406 RKT---------------EDAYLELADQMVKENPELALMGSCVLVTLMKGEDVYVMNVGDSRAVL 455

  Fly   286 -------VGKRTQ-----------------------------LQLVKPH-----------KPENP 303
                   .|::.|                             |||...|           |.|:|
plant   456 GRKPNLATGRKRQKELERIREDSSLEDKEILMNGAMRNTLVPLQLNMEHSTRIEEEVRRIKKEHP 520

  Fly   304 DERKRIETAGGTVLHAQGQWRVNGILNVARSIG----------DYSLEA-----------VIAEP 347
            |:...:|..           ||.|.|.|.|:.|          |..||.           :...|
plant   521 DDDCAVEND-----------RVKGYLKVTRAFGAGFLKQPKWNDALLEMFRIDYIGTSPYITCSP 574

  Fly   348 DFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLA-----DTTMKLDDIPKLLIEAAKE-- 405
            .....:|.....||:|.:|||:::......|..|...::     |....|  |.::|:.||.:  
plant   575 SLCHHKLTSRDKFLILSSDGLYEYFSNQEAIFEVESFISAFPEGDPAQHL--IQEVLLRAANKFG 637

  Fly   406 --------------RDSQDNITAVVVLLKPR 422
                          |...|:::.:|:.|:.|
plant   638 MDFHELLEIPQGDRRRYHDDVSVIVISLEGR 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 66/350 (19%)
PLL2NP_195860.1 PP2Cc 259..665 CDD:238083 82/416 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.