DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT5G06750

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001119181.1 Gene:AT5G06750 / 830564 AraportID:AT5G06750 Length:393 Species:Arabidopsis thaliana


Alignment Length:283 Identity:72/283 - (25%)
Similarity:109/283 - (38%) Gaps:63/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAF---ESAFLLADERFTQKK 256
            |.||:|||.|..::.|.:.   .|.:..::.:.:.:..|.:..|.||   |..||....|....|
plant    82 FVGVYDGHGGPEASRYISD---HLFSHLMRVSRERSCISEEALRAAFSATEEGFLTLVRRTCGLK 143

  Fly   257 ITSGTTSVCAL---ITKDQLYIAWVGDSKALL---------VGKRTQLQLVKPHKPENPDERKRI 309
            ........|.|   |.|..|.||.||||:|:|         ..|....||...|.....:.|:.:
plant   144 PLIAAVGSCCLVGVIWKGTLLIANVGDSRAVLGSMGSNNNRSNKIVAEQLTSDHNAALEEVRQEL 208

  Fly   310 ETA----GGTVLHAQGQWRVNGILNVARSIGD-------YSLE---------------AVIAEPD 348
            .:.    ...|:...|.||:.||:.|:|||||       :||:               .:.|||.
plant   209 RSLHPDDSHIVVLKHGVWRIKGIIQVSRSIGDAYLKRPEFSLDPSFPRFHLAEELQRPVLSAEPC 273

  Fly   349 FVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYD-----------------SLADTTMKLDDIP 396
            .....|..:..|::..:||||:.:.....:|.|..                 :.....|..||:.
plant   274 VYTRVLQTSDKFVIFASDGLWEQMTNQQAVEIVNKHPRPGIARRLVRRAITIAAKKREMNYDDLK 338

  Fly   397 KLLIEAAKERDSQDNITAVVVLL 419
            |  :|....|...|:||.||:.:
plant   339 K--VERGVRRFFHDDITVVVIFI 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 72/281 (26%)
AT5G06750NP_001119181.1 PP2Cc 63..359 CDD:238083 72/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.