DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT4G38520

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_195564.2 Gene:AT4G38520 / 830009 AraportID:AT4G38520 Length:400 Species:Arabidopsis thaliana


Alignment Length:296 Identity:77/296 - (26%)
Similarity:122/296 - (41%) Gaps:96/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FFGVFDGHSGSLSATYATS----QLPQLLADQLKANPDPAAFSPDFYRNAF---ESAFL-LADER 251
            |.||:|||.|..::.:...    .|.:..|:|       ...|.:..:.||   |..|| :...:
plant    81 FVGVYDGHGGPETSRFINDHMFHHLKRFTAEQ-------QCMSSEVIKKAFQATEEGFLSIVTNQ 138

  Fly   252 F-TQKKI-TSGTTSVCALITKDQLYIAWVGDSKALL------VGKRTQLQLVKPHK--------- 299
            | |:.:| |.|:..:.::|...:||:|..|||:|:|      .|:....||...|.         
plant   139 FQTRPQIATVGSCCLVSVICDGKLYVANAGDSRAVLGQVMRVTGEAHATQLSAEHNASIESVRRE 203

  Fly   300 -----PENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGD---------------------- 337
                 |::||          .|:.....|||.||:.|:|||||                      
plant   204 LQALHPDHPD----------IVVLKHNVWRVKGIIQVSRSIGDVYLKRSEFNREPLYAKFRLRSP 258

  Fly   338 YSLEAVIAEPDFVDVQLNEAHD-FLVLGTDGLWDHVPESLIIETVY----DSLADTTMKLDDIPK 397
            :|...:.||| .:.|...|.|| |::..:||||:|:.....::.|.    :.:|...:|:     
plant   259 FSKPLLSAEP-AITVHTLEPHDQFIICASDGLWEHMSNQEAVDIVQNHPRNGIAKRLVKV----- 317

  Fly   398 LLIEAAKERDSQ----------------DNITAVVV 417
            .|.||||:|:.:                |:||.:||
plant   318 ALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 77/296 (26%)
AT4G38520NP_195564.2 PP2Cc 74..353 CDD:214625 75/294 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.