DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT4G33920

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_195118.1 Gene:AT4G33920 / 829536 AraportID:AT4G33920 Length:380 Species:Arabidopsis thaliana


Alignment Length:326 Identity:82/326 - (25%)
Similarity:127/326 - (38%) Gaps:92/326 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQL-PQLLADQLKA 225
            |.||.....::||         :.......:..:.||:|||.|..::.:....| |.:    .|.
plant    37 SIAVVQANSRLED---------QSQVFTSSSATYVGVYDGHGGPEASRFVNRHLFPYM----HKF 88

  Fly   226 NPDPAAFSPDFYRNAF---ESAFLLADERFTQKKITSGTTSVCAL---ITKDQLYIAWVGDSKAL 284
            ..:....|.|..:.||   |..|....:|....|....|...|.|   |:.|.||:|.:|||:|:
plant    89 AREHGGLSVDVIKKAFKETEEEFCGMVKRSLPMKPQMATVGSCCLVGAISNDTLYVANLGDSRAV 153

  Fly   285 L-------------VGKRTQL-------QLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGIL 329
            |             |.:|...       ::.|..|..|||:.:       .||:.:|.||:.||:
plant   154 LGSVVSGVDSNKGAVAERLSTDHNVAVEEVRKEVKALNPDDSQ-------IVLYTRGVWRIKGII 211

  Fly   330 NVARSIGDYSLE----------------------AVIAEPDFVDVQLNEAHDFLVLGTDGLWDHV 372
            .|:|||||..|:                      |:.|||..:..:|.....||:..:||||:|:
plant   212 QVSRSIGDVYLKKPEYYRDPIFQRHGNPIPLRRPAMTAEPSIIVRKLKPQDLFLIFASDGLWEHL 276

  Fly   373 PESLIIETVY-----------------DSLADTTMKLDDIPKLLIEAAK--ERDSQDNITAVVVL 418
            .:...:|.|.                 ::.....|:..||.|:    ||  .|...|:|:.:||.
plant   277 SDETAVEIVLKHPRTGIARRLVRAALEEAAKKREMRYGDIKKI----AKGIRRHFHDDISVIVVY 337

  Fly   419 L 419
            |
plant   338 L 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 81/324 (25%)
AT4G33920NP_195118.1 PP2Cc 42..338 CDD:238083 78/319 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.