DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT4G33500

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_567923.1 Gene:AT4G33500 / 829488 AraportID:AT4G33500 Length:724 Species:Arabidopsis thaliana


Alignment Length:422 Identity:87/422 - (20%)
Similarity:149/422 - (35%) Gaps:122/422 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LVSTAEKAAAVSEEVVSRSCVTRTANETYKVSGEERHAELVSAIWKQ-LETRGCPAQFRIKLLHR 84
            :|.....||..|:|::|.|..||.:.:      |.....::....|. :||...|     :.:|.
plant   345 VVEPTATAAVSSDELISTSEATRHSVD------EIAQKPIIDTSEKNPMETFVEP-----EAVHS 398

  Fly    85 STQQLEQDLCFAKECEVTVEGPPQYDLLKLQKFVASEFEKYIL---KLTDNSEVDRLKDFADE-- 144
            |..:..:.|       |.|....:.|    .:.|||..|..|.   .:||:..:....|...|  
plant   399 SVDESTEKL-------VVVTSDVEND----GENVASTTEDEITVRDTITDSGSISNNDDTKVEDL 452

  Fly   145 --AAPENCECHQQKEPLHTSAAVKNKPRKMEDRCVCLDR-FGEMYE----LLDKTTRFF------ 196
              ..||....    ||:..::.    ..::..:...||. |..:..    |..:...:|      
plant   453 QLPVPETASL----EPIKAASG----REELVSKAFYLDSGFASLQSPFKALAGREDAYFISHHNW 509

  Fly   197 -GVFDGHS-----GSLSATYA---TSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERF 252
             |:.||.|     |.....||   .|...::::::.....||...   .:|:..|:         
plant   510 IGIADGVSQWSFEGINKGMYAQELMSNCEKIISNETAKISDPVQV---LHRSVNET--------- 562

  Fly   253 TQKKITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKP---------HKPENPDERKR 308
               |.:..:|::.|.:..::|:||.:|||..:::...|.||...|         |..:..|..|.
plant   563 ---KSSGSSTALIAHLDNNELHIANIGDSGFMVIRDGTVLQNSSPMFHHFCFPLHITQGCDVLKL 624

  Fly   309 IETAGGTVLHAQGQWRVNGILNVARSIGDYSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVP 373
            .|     |.|                                 |.|.|. |.::..||||:|::.
plant   625 AE-----VYH---------------------------------VNLEEG-DVVIAATDGLFDNLY 650

  Fly   374 ESLIIETVYDSLADTTMKLDDIPKLLIEAAKE 405
            |..|:..|..||.. :::...|.:|:...|:|
plant   651 EKEIVSIVCGSLKQ-SLEPQKIAELVAAKAQE 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 54/275 (20%)
AT4G33500NP_567923.1 DUF4775 <208..473 CDD:292620 33/157 (21%)
PP2Cc 499..683 CDD:294085 50/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.