DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT4G32950

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_195021.1 Gene:AT4G32950 / 829432 AraportID:AT4G32950 Length:326 Species:Arabidopsis thaliana


Alignment Length:337 Identity:84/337 - (24%)
Similarity:147/337 - (43%) Gaps:77/337 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 TDNSEVDRLKDFADEAA---------PENCECHQQ---KEPLHTSAAVKNKPRKMEDRCVCLDRF 182
            ||.|::..:.|:..|.|         |:|......   .:.|:..||:.:.....|:..:|    
plant    13 TDKSQIYEITDYGQENAVLYSDHHVVPQNLGSVSSLAGGKGLNQDAAILHLGYGTEEGALC---- 73

  Fly   183 GEMYELLDKTTRFFGVFDGHS--GSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAF 245
                          ||||||.  |:..:....:|||.:|...:..:    :.:.| ::...|::.
plant    74 --------------GVFDGHGPRGAFVSKNVRNQLPSILLGHMNNH----SVTRD-WKLICETSC 119

  Fly   246 LLADERFTQ-KKI----TSGTTSVCALITKDQLYIAWVGDSKALLVGK----RTQL-QLVKPHKP 300
            |..|:|..: |||    .||||:|.|:...:|:.:|.:|||:|:::|.    .|:: ||....||
plant   120 LEMDKRILKVKKIHDCSASGTTAVLAVKHGNQVMVANLGDSRAVMIGTSEDGETKVAQLTNDLKP 184

  Fly   301 ENPDERKRIETAGGTVLHAQGQWRVNGI---------LNVARSIGDYSLEA--VIAEPDFVDVQL 354
            ..|.|.:||....|.||..:.:..:..:         |.::|:.||:.|::  |||.|.....|:
plant   185 SVPSEAERIRKRNGRVLALESEPHILRVWLPTENRPGLAMSRAFGDFLLKSYGVIATPQVSTHQI 249

  Fly   355 NEAHDFLVLGTDGLWDHVPESLIIETVYDSLADT-------------------TMKLDDIPKLLI 400
            ..:..||:|.:||:||.:....:...|..|.::.                   |:|:|||..:.:
plant   250 TSSDQFLLLASDGVWDVLSNEEVATVVMKSASEAGAANEVAEAATNAWIQKFPTVKIDDISVVCL 314

  Fly   401 EAAKERDSQDNI 412
            ...|:.:.|..|
plant   315 SLNKKHNPQPQI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 75/295 (25%)
AT4G32950NP_195021.1 PP2Cc 43..316 CDD:238083 73/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.