DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and WIN2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001328538.1 Gene:WIN2 / 829303 AraportID:AT4G31750 Length:311 Species:Arabidopsis thaliana


Alignment Length:264 Identity:93/264 - (35%)
Similarity:143/264 - (54%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 AAVKNKPRKMEDRCVCLDRFGEMYEL-LD----KTTRFFGVFDGHSGSLSATYATSQLPQLLADQ 222
            |:...|...|||          .||. :|    :....|||||||.|:.:|.|....|...|...
plant    37 ASSPGKRSSMED----------FYETRIDGVEGEIVGLFGVFDGHGGARAAEYVKQNLFSNLIRH 91

  Fly   223 LKANPDPAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALITKDQLYIAWVGDSKALLVG 287
            .|...|..|...|.| |..:|.||.::.  :|.: .:|:|:..|::..|:|.:|.||||:|::..
plant    92 PKFISDTTAAIADAY-NQTDSEFLKSEN--SQNR-DAGSTASTAILVGDRLLVANVGDSRAVICR 152

  Fly   288 KRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL-EAVIAEPDFVD 351
            ....:.:.:.|||:..|||:|||.|||.|:.| |.|||.|:|.|:|:.||..| :.|:|:|:..:
plant   153 GGNAIAVSRDHKPDQSDERQRIEDAGGFVMWA-GTWRVGGVLAVSRAFGDRLLKQYVVADPEIQE 216

  Fly   352 VQLNEAHDFLVLGTDGLWDHV--PESL-IIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNIT 413
            .:::.:.:||:|.:|||||.|  .|:: :|:.:.|.        ::..|.|:..|.:|.|.||||
plant   217 EKVDSSLEFLILASDGLWDVVSNEEAVGMIKAIEDP--------EEGAKRLMMEAYQRGSADNIT 273

  Fly   414 AVVV 417
            .|||
plant   274 CVVV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 93/264 (35%)
WIN2NP_001328538.1 PP2Cc 32..279 CDD:238083 93/264 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.