DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and TAP38

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_194509.1 Gene:TAP38 / 828893 AraportID:AT4G27800 Length:388 Species:Arabidopsis thaliana


Alignment Length:295 Identity:80/295 - (27%)
Similarity:126/295 - (42%) Gaps:69/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 KMED----RCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQ-----LLADQLKAN 226
            :|||    |...:|.|.           :..|||||:||.|..:...:|.:     |.|..|...
plant    71 EMEDDIVIRSDAVDSFS-----------YAAVFDGHAGSSSVKFLREELYKECVGALQAGSLLNG 124

  Fly   227 PDPAAFSPDFYRNAFESA---FLLADERFTQKKITSGTTSVCALITKDQLYIAWVGDSKALLVGK 288
            .|.||......: ||||.   .|...|....::..||:|:...:|..|..:||.:|||.|:|...
plant   125 GDFAAIKEALIK-AFESVDRNLLKWLEANGDEEDESGSTATVMIIRNDVSFIAHIGDSCAVLSRS 188

  Fly   289 RTQLQLVKPHKPENP-----DERKRIETAGGTVLHAQGQWRVNGILNVARSIGD----------- 337
            ....:|...|:|...     .|.||::.|||.:::.    |:.|.:.|:|:.||           
plant   189 GQIEELTDYHRPYGSSRAAIQEVKRVKEAGGWIVNG----RICGDIAVSRAFGDIRFKTKKNDML 249

  Fly   338 ------------------YSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDS 384
                              :..:.|:|.||...|.|....:|::|.:|||||::..|.::..|.|.
plant   250 KKGVDEGRWSEKFVSRIEFKGDMVVATPDIFQVPLTSDVEFIILASDGLWDYMKSSDVVSYVRDQ 314

  Fly   385 LADTTMKLDDIP---KLLIEAAKERDSQDNITAVV 416
            |    .|..::.   :.|.:.|.:|.|||||:.::
plant   315 L----RKHGNVQLACESLAQVALDRRSQDNISIII 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 80/295 (27%)
TAP38NP_194509.1 PP2Cc 58..348 CDD:238083 80/295 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.