DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ABI1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_194338.1 Gene:ABI1 / 828714 AraportID:AT4G26080 Length:434 Species:Arabidopsis thaliana


Alignment Length:346 Identity:104/346 - (30%)
Similarity:159/346 - (45%) Gaps:66/346 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EKYILKLTDNSEVDRLKDFADEAAPENCECHQQKEPLHTSAAVKNKPRKMEDRCVCLDRF----- 182
            ||.::..|::..:...|..                ||:...::..:..:|||....:.||     
plant   108 EKKMISRTESRSLFEFKSV----------------PLYGFTSICGRRPEMEDAVSTIPRFLQSSS 156

  Fly   183 GEMYELLD------KTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDF----Y 237
            |.|   ||      ....||||:|||.||..|.|...::...||::: |...|.....|.    :
plant   157 GSM---LDGRFDPQSAAHFFGVYDGHGGSQVANYCRERMHLALAEEI-AKEKPMLCDGDTWLEKW 217

  Fly   238 RNAFESAFLLADERF-TQKKITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPE 301
            :.|..::||..|... :....|.|:|||.|::....:::|..|||:|:|...:|.|.|...|||:
plant   218 KKALFNSFLRVDSEIESVAPETVGSTSVVAVVFPSHIFVANCGDSRAVLCRGKTALPLSVDHKPD 282

  Fly   302 NPDERKRIETAGGTVLHAQGQW---RVNGILNVARSIGD-YSLEAVIAEPDFVDVQLNEAHDFLV 362
            ..||..|||.|||.|:    ||   ||.|:|.::||||| |...::|.:|:...|:..:..|.|:
plant   283 REDEAARIEAAGGKVI----QWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVTAVKRVKEDDCLI 343

  Fly   363 LGTDGLWDHVPESLIIETV----------------YDSLADTTMKLDDIP------KLLIEAAKE 405
            |.:||:||.:.:....|..                ...|||...|....|      :.|.:.|.:
plant   344 LASDGVWDVMTDEEACEMARKRILLWHKKNAVAGDASLLADERRKEGKDPAAMSAAEYLSKLAIQ 408

  Fly   406 RDSQDNITAVVVLLKPRHQIE 426
            |.|:|||:.|||.||||.:::
plant   409 RGSKDNISVVVVDLKPRRKLK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 94/300 (31%)
ABI1NP_194338.1 PP2Cc 119..420 CDD:214625 95/324 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.