DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PP2C52

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001190668.1 Gene:PP2C52 / 827930 AraportID:AT4G03415 Length:468 Species:Arabidopsis thaliana


Alignment Length:289 Identity:77/289 - (26%)
Similarity:118/289 - (40%) Gaps:61/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 ELLDKTTRFFGVFDGHS--GSLSATYATSQLP---QLLADQLKANPDPAAFSPDFYRNAFESAFL 246
            :.:.:...|.||||||.  |.|.|......||   |.....|::..: .:....|.||:.:||..
plant    89 DFMSEDVTFCGVFDGHGPYGHLVARKVRDTLPVKLQFFFQTLQSKQN-CSKGTRFRRNSSKSAVQ 152

  Fly   247 LA-----DE---------------RFTQKKI---------TSGTTSVCALITKDQLYIAWVGDSK 282
            .|     ||               :...|::         .||:|.|..|.....|::..:|||:
plant   153 EAVKEGSDEDKLKGLWGEAFLKSFKAMDKELRSHPNLDCFCSGSTGVTILKQGSNLFMGNIGDSR 217

  Fly   283 ALLVGKRTQ-----LQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGI---------LNVAR 333
            |:|..|.:.     .||....||:.|.|.:||:...|.|...:.:..|..:         |.:||
plant   218 AILGSKDSNDSMVATQLTVDLKPDLPREAERIKRCKGRVFAMEDEPEVPRVWLPYDDAPGLAMAR 282

  Fly   334 SIGDYSLE--AVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIP 396
            :.||:.|:  .||:.|:|....|.:...|:||.:||:||    .|..|.|.|.:|..|.:.....
plant   283 AFGDFCLKEYGVISVPEFTHRVLTDRDQFIVLASDGVWD----VLSNEEVVDIVASATSRASAAR 343

  Fly   397 KLLIEAAKE------RDSQDNITAVVVLL 419
            .|:..||:|      ....|:...|.:.|
plant   344 TLVNSAAREWKLKYPTSKMDDCAVVCLFL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 76/287 (26%)
PP2C52NP_001190668.1 PP2Cc 73..372 CDD:238083 76/287 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.