DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT4G08260

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_192566.1 Gene:AT4G08260 / 826376 AraportID:AT4G08260 Length:212 Species:Arabidopsis thaliana


Alignment Length:246 Identity:65/246 - (26%)
Similarity:112/246 - (45%) Gaps:44/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DRFGEMYELL-DKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFES 243
            |||..:..|. |.....|||:.||.|..:|.:|...|.:.:.:::                  ..
plant     3 DRFSAITNLHGDHKQAIFGVYVGHGGVKAAEFAAKNLDKNIVEEV------------------VD 49

  Fly   244 AFLLADERFTQKKITSGTTSVCALITKDQLYIAWVGDSKALL-VGKRTQLQLVKPHKPENPDERK 307
            |..|.:|.|     ..|::.|.||:::..|.::..||.:|:: ||:....:.:||.:        
plant    50 ATFLKEEGF-----KGGSSCVTALVSEGSLVVSNAGDCRAVMSVGEMMNGKELKPRE-------- 101

  Fly   308 RIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEA-VIAEPDFVDVQLNEAHDFLVLGTDGLWDH 371
                   .:|.....||:.|.|.|.|.|||..|:. |||||:....::...|:||:|.:.||||.
plant   102 -------DMLIRFTLWRIQGSLVVPRGIGDAQLKKWVIAEPETKISRVEHDHEFLILASHGLWDK 159

  Fly   372 V--PESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITAVVVLLK 420
            |  .|::.|...:....:..:.|....| |::.:..|.|.|:|:.:::.|:
plant   160 VSNQEAVDIARPFCLRTEKPLLLAACKK-LVDLSASRGSFDDISVMLIPLR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 64/243 (26%)
AT4G08260NP_192566.1 PP2Cc 1..208 CDD:238083 64/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.