DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G62260

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_850737.1 Gene:AT3G62260 / 825399 AraportID:AT3G62260 Length:384 Species:Arabidopsis thaliana


Alignment Length:279 Identity:86/279 - (30%)
Similarity:137/279 - (49%) Gaps:51/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RKMEDRCVCLD----RFGEMYELLDKTTRFFGVFDGHSGSLSATYA----------------TSQ 214
            |.|||..:.:|    :.|.::| |.|.:.|:.|||||.|..:|.|.                ||:
plant    89 RNMEDEHIRIDDLSSQVGSLFE-LPKPSAFYAVFDGHGGPEAAAYVRENAIRFFFEDEQFPQTSE 152

  Fly   215 LPQLLADQLKANPDPAAFSPDFYRNAFESAFL-LADERFTQKKITSGTTSVCALITKDQLYIAWV 278
            :..:..::::.:          .||||..|.| ||::  .....:.|||::.|||....|.:|..
plant   153 VSSVYVEEVETS----------LRNAFLQADLALAED--CSISDSCGTTALTALICGRLLMVANA 205

  Fly   279 GDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLE-- 341
            ||.:|:|..|...:.:.:.|||.|..||:|:|.:||.:.:   ...:|.:|.|.|::||:.|:  
plant   206 GDCRAVLCRKGRAIDMSEDHKPINLLERRRVEESGGFITN---DGYLNEVLAVTRALGDWDLKLP 267

  Fly   342 -----AVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSL---ADTTMKLDDIPKL 398
                 .:|:||:...:.|.|..:|||:|.||:||.:.....:..|...|   .|.|.    ..:.
plant   268 HGSQSPLISEPEIKQITLTEDDEFLVIGCDGIWDVLTSQEAVSIVRRGLNRHNDPTR----CARE 328

  Fly   399 LIEAAKERDSQDNITAVVV 417
            |:..|..|:|.||:|||||
plant   329 LVMEALGRNSFDNLTAVVV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 86/279 (31%)
AT3G62260NP_850737.1 PP2Cc 78..349 CDD:238083 86/279 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.