DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G51470

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_190715.1 Gene:AT3G51470 / 824310 AraportID:AT3G51470 Length:361 Species:Arabidopsis thaliana


Alignment Length:282 Identity:92/282 - (32%)
Similarity:145/282 - (51%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 EPLHTSAAVKNKPRK--MEDRCVCLDRFGEMYELLDKTT-RFFGVFDGHSGSLSATYATSQLPQL 218
            :|:..|.:..:|..|  |||..:|:|   ::.|.:..:| .|:||||||.|..:|::....:.:|
plant    68 QPVFRSGSWSDKGPKQSMEDEFICVD---DLTEYIGSSTGAFYGVFDGHGGVDAASFTKKNIMKL 129

  Fly   219 LADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQKKI---TSGTTSVCALITKDQLYIAWVGD 280
            :.:.        ...|...:.|..|||:..|........   :||||::.|||....:.||..||
plant   130 VMED--------KHFPTSTKKATRSAFVKTDHALADASSLDRSSGTTALTALILDKTMLIANAGD 186

  Fly   281 SKALLVGKRTQ-LQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDY------ 338
            |:|:| |||.: ::|.|.|||....||.|||..||.:....    :||.|:|||::||:      
plant   187 SRAVL-GKRGRAIELSKDHKPNCTSERLRIEKLGGVIYDGY----LNGQLSVARALGDWHIKGTK 246

  Fly   339 -SLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDD---IPKLL 399
             ||..:..||:..::.|.|..::|::|.|||||.:.....:..|...|    |:.:|   ..:.|
plant   247 GSLCPLSCEPELEEIVLTEEDEYLIMGCDGLWDVMSSQCAVTMVRREL----MQHNDPERCSQAL 307

  Fly   400 IEAAKERDSQDNITAVVVLLKP 421
            ::.|.:|:|.||:|.|||...|
plant   308 VKEALQRNSCDNLTVVVVCFSP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 90/275 (33%)
AT3G51470NP_190715.1 PP2C_C 58..361 CDD:421906 92/282 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.