DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G51370

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001327130.1 Gene:AT3G51370 / 824300 AraportID:AT3G51370 Length:379 Species:Arabidopsis thaliana


Alignment Length:291 Identity:71/291 - (24%)
Similarity:120/291 - (41%) Gaps:82/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FFGVFDGHSGSLSATYATSQLPQLL----ADQLKANPDPAAFSPDFYRNAFESAFLLADERF--- 252
            |.|::|||.|..::.:....|.|.|    |:|       |:.|.|..:.|:|:    .:|.|   
plant    79 FIGIYDGHGGPETSRFVNDHLFQHLKRFAAEQ-------ASMSVDVIKKAYEA----TEEGFLGV 132

  Fly   253 ------TQKKITS-GTTSVCALITKDQLYIAWVGDSKALL------VGKRTQLQLVKPHKPENPD 304
                  |:.:|.: |:..:..:|....||||.||||:|:|      .|:...|||...|......
plant   133 VTKQWPTKPQIAAVGSCCLVGVICGGMLYIANVGDSRAVLGRAMKATGEVIALQLSAEHNVSIES 197

  Fly   305 ERKRIETA----GGTVLHAQGQWRVNGILNVARSIGDYSLE----------------------AV 343
            .|:.:.:.    ...|:.....|||.|::.::|||||..|:                      .:
plant   198 VRQEMHSLHPDDSHIVMLKHNVWRVKGLIQISRSIGDVYLKKAEFNKEPLYTKYRIREPFKRPIL 262

  Fly   344 IAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVY----DSLADTTMKLDDIPKLLIEAAK 404
            ..||...:.::.....||:..:||||:.:.....::.|.    :.:|...:|:     .|.||||
plant   263 SGEPTITEHEIQPQDKFLIFASDGLWEQMSNQEAVDIVQNHPRNGIARRLVKM-----ALQEAAK 322

  Fly   405 ERDSQ----------------DNITAVVVLL 419
            :|:.:                |:||.|::.|
plant   323 KREMRYSDLKKIERGVRRHFHDDITVVIIFL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 70/289 (24%)
AT3G51370NP_001327130.1 PP2Cc 46..353 CDD:238083 70/289 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.