DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G27140

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_189350.2 Gene:AT3G27140 / 822333 AraportID:AT3G27140 Length:245 Species:Arabidopsis thaliana


Alignment Length:246 Identity:59/246 - (23%)
Similarity:101/246 - (41%) Gaps:62/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DRFGEMYELL-DKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFES 243
            |||..:..|. |:....|||:.||.|..:|......|.:.:.:::...           |:..|.
plant     3 DRFSTITNLHGDRKQAIFGVYVGHGGVKAAECPAKNLDKNIVEEVVGK-----------RHELEI 56

  Fly   244 AFLLADERFTQKKITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKR 308
            |            ...|::.|.||:::..|.::..||.:|::                       
plant    57 A------------EAGGSSCVTALVSEGSLVVSNAGDCRAVM----------------------- 86

  Fly   309 IETAGGTVLHAQGQWRVNGILNVARSIGDYSLEA-VIAEPDFVDVQLNEAHDFLVLGTDGLWDHV 372
              :.||.         ..|.|.|.|.|||..|:. |||||:....::...|:||:|.:.||||.|
plant    87 --SVGGV---------AKGSLVVPRGIGDAQLKKWVIAEPETKISRVEHDHEFLILASHGLWDKV 140

  Fly   373 --PESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITAVVVLLKP 421
              .|::.|...:....:..:.|....| |::.:..|.|.|:|:.:::.|:|
plant   141 SNQEAVDIARPFCLRTEKPLLLAACKK-LVDLSASRGSFDDISVMLIPLRP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 57/242 (24%)
AT3G27140NP_189350.2 PP2Cc 1..188 CDD:238083 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.