DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G22750

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_566716.1 Gene:AT3G22750 / 821846 AraportID:AT3G22750 Length:378 Species:Arabidopsis thaliana


Alignment Length:102 Identity:19/102 - (18%)
Similarity:40/102 - (39%) Gaps:30/102 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DNSEVDRLKDF-ADEAAPENCECHQQKEPLHT-SAAVKNKPRKMED-----------RCVCLDRF 182
            :||:.|.:  | ||:...:|.:...:|..... |.:::..|:..|:           ..:....:
plant    23 NNSKKDMI--FRADKIDLKNLDIQLEKHLSRVWSRSIEKHPKPKEEWEIELAKLEMRNVIARGAY 85

  Fly   183 GEMYELLDKTTRFFGVFDGHSGSLSAT------YATS 213
            |.:|:         |::||...::...      |||:
plant    86 GIVYK---------GIYDGQDVAVKVLDWGEDGYATT 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 11/72 (15%)
AT3G22750NP_566716.1 Pkinase_Tyr 74..349 CDD:285015 8/49 (16%)
STKc_MAP3K-like 80..349 CDD:270901 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.