DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G17090

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_566566.1 Gene:AT3G17090 / 820966 AraportID:AT3G17090 Length:384 Species:Arabidopsis thaliana


Alignment Length:318 Identity:85/318 - (26%)
Similarity:130/318 - (40%) Gaps:79/318 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SAAVKNKPRKMEDRC-VCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKA 225
            |.||....:.:||:. |....||          .|.||:|||.|..:|.|....|..... ::.|
plant    60 SMAVIQANQVLEDQSQVESGNFG----------TFVGVYDGHGGPEAARYVCDHLFNHFR-EISA 113

  Fly   226 NPDPAAFSPDFYRNAFESAFLLADERFTQ----------KKITSGTTSVCALITKDQLYIAWVGD 280
            ......     .|...|.||...:|.|..          ...|.||..:..:|.::.|::|.:||
plant   114 ETQGVV-----TRETIERAFHATEEGFASIVSELWQEIPNLATVGTCCLVGVIYQNTLFVASLGD 173

  Fly   281 SKALLVGKR------TQLQLVKPHKPENPDERKRIETA----GGTVLHAQGQWRVNGILNVARSI 335
            |:.:| ||:      :.:||...|...|.|.|..::..    ...|:...|.|||.||:.|:|||
plant   174 SRVVL-GKKGNCGGLSAIQLSTEHNANNEDIRWELKDLHPDDPQIVVFRHGVWRVKGIIQVSRSI 237

  Fly   336 GD-------YSLEAV-----IAE----------PDFVDVQLNEAHDFLVLGTDGLWDHVPESLII 378
            ||       ::.|.:     |||          |..:...|:....||:..:||||:|:.....:
plant   238 GDMYMKRPEFNKEPISQKFRIAEPMKRPLMSATPTILSHPLHPNDSFLIFASDGLWEHLTNEKAV 302

  Fly   379 ETVYD-SLADTTMKLDDIPKLLIEAAKERDSQ----------------DNITAVVVLL 419
            |.|:: ..|.:..:|  |...|.|||::|:.:                |:||.:||.|
plant   303 EIVHNHPRAGSAKRL--IKAALHEAARKREMRYSDLRKIDKKVRRHFHDDITVIVVFL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 84/316 (27%)
AT3G17090NP_566566.1 PP2Cc 59..358 CDD:238083 84/316 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.