DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G02750

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001030625.1 Gene:AT3G02750 / 820909 AraportID:AT3G02750 Length:527 Species:Arabidopsis thaliana


Alignment Length:374 Identity:84/374 - (22%)
Similarity:135/374 - (36%) Gaps:134/374 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 HQQKEPLH-----------TSAAV----KNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGH 202
            ::::|||:           |..|.    :.|....:|..|..:.||...:     |.|.||||||
plant    43 YRREEPLNQVPGRMFLNGSTEVACIYTQQGKKGPNQDAMVVWENFGSRTD-----TIFCGVFDGH 102

  Fly   203 S--GSLSATYATSQLPQLLA----------DQLKA-------------NPDPAAFS--------- 233
            .  |.:.|......||..|:          ..|||             ||:.||.:         
plant   103 GPYGHMVAKRVRDNLPLKLSAYWEAKVPVEGVLKAITTDTVNNVTNINNPEDAAAAAAFVTAEEE 167

  Fly   234 ---------------PDFY---RNAFESAFLLADERF----TQKKITSGTTSVCALITKDQLYIA 276
                           |:.:   :.:|..||.:.|...    :.....||||:|..:.....|.:.
plant   168 PRTSADMEEENTETQPELFQTLKESFLKAFKVMDRELKFHGSVDCFCSGTTAVTLIKQGQYLVVG 232

  Fly   277 WVGDSKALLVGKRTQLQLV--------KPHKP--------------------------------E 301
            .||||:|::..:.::..||        ||:.|                                |
plant   233 NVGDSRAVMGTRDSENTLVAVQLTVDLKPNLPGWIILCECMMLSCGCMMDPLIMFIGFFFIPSIE 297

  Fly   302 NPDERKRIETAGGTVLHAQGQ------WRVN----GILNVARSIGDYSLE--AVIAEPDFVDVQL 354
            ...|.:||....|.|...:.:      |..|    | |.:||:.||:.|:  .:|:.||....||
plant   298 LAAEAERIRKCRGRVFALRDEPEVCRVWLPNCDSPG-LAMARAFGDFCLKDFGLISVPDVSFRQL 361

  Fly   355 NEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAA 403
            .|..:|:||.|||:||.:....::..|..:.:.::     ..:.|:|:|
plant   362 TEKDEFIVLATDGIWDVLSNEDVVAIVASAPSRSS-----AARALVESA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 81/367 (22%)
AT3G02750NP_001030625.1 PP2Cc 64..428 CDD:238083 80/353 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.