DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G15260

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_188144.1 Gene:AT3G15260 / 820757 AraportID:AT3G15260 Length:289 Species:Arabidopsis thaliana


Alignment Length:272 Identity:81/272 - (29%)
Similarity:126/272 - (46%) Gaps:33/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KEPLHTSAAVKNKP-RKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLL 219
            |:..|....||.|. .:|||..|     .:..|:.|.....|.:||||        .:.::|..|
plant    38 KQITHGFHLVKGKAFHEMEDYVV-----AKFKEVDDNELGLFAIFDGH--------LSHEIPDYL 89

  Fly   220 ADQLKANPDPAAFSPDFYR---NAFESAFLLADERFTQKKI---TSGTTSVCA-LITKDQLYIAW 277
            ...|..|   ....|:|::   .|.:.|:.:.|.....|..   ..|:|:|.| ||...:|.:|.
plant    90 CSHLFEN---ILKEPNFWQEPEKAIKKAYYITDTTILDKADDLGKGGSTAVTAILINCQKLVVAN 151

  Fly   278 VGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQW-RVNGILNVARSIGDYSLE 341
            ||||:|::........|...|:|..  |:..||..||.|.:..|.. ||:|.|.|||:.||.||:
plant   152 VGDSRAVICQNGVAKPLSVDHEPNM--EKDEIENRGGFVSNFPGDVPRVDGQLAVARAFGDKSLK 214

  Fly   342 AVIAEPDFVDVQ-LNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKE 405
            ..::...:|.|: :::..:||:|.:||||..:.....:::: ..:.|...    ..|.|.|.|..
plant   215 MHLSSEPYVTVEIIDDDAEFLILASDGLWKVMSNQEAVDSI-KGIKDAKA----AAKHLAEEAVA 274

  Fly   406 RDSQDNITAVVV 417
            |.|.|:|:.|||
plant   275 RKSSDDISVVVV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 80/268 (30%)
AT3G15260NP_188144.1 PP2Cc 42..288 CDD:238083 80/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.