DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PLL3

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_187551.1 Gene:PLL3 / 820099 AraportID:AT3G09400 Length:650 Species:Arabidopsis thaliana


Alignment Length:425 Identity:79/425 - (18%)
Similarity:129/425 - (30%) Gaps:171/425 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PPQYDLLKLQKFVASEF---------EKYILKLTDNSEVDRLKDFADEAAPENCECHQQKEPLHT 161
            ||.|.:..|...|..|.         |.|......|.|.....:.|.::..|||......:....
plant   283 PPDYLIKNLYTAVLRELKGLLWIDKGESYNRNGESNIEKQSTVEHASDSDQENCPVMNGNDVACG 347

  Fly   162 SAAVKNKPRKMEDRCVC-------------LDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATS 213
            |..:.:..:|::.||..             .|....:.:.|:||...|                 
plant   348 SRNITSDVKKLQWRCEWEHNSSNKSNNINHKDVLRALQQALEKTEESF----------------- 395

  Fly   214 QLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALITKDQLYIAWV 278
                    .|..|.:|            |.|.:             |:..:..|:..:.:|:..|
plant   396 --------DLMVNENP------------ELALM-------------GSCVLVTLMKGEDVYVMSV 427

  Fly   279 GDSKALLVGK--------RTQLQLVKPHKP----------------------------------- 300
            |||:|:|..:        :.:|:.||...|                                   
plant   428 GDSRAVLARRPNVEKMKMQKELERVKEESPLETLFITERGLSLLVPVQLNKEHSTSVEEEVRRIK 492

  Fly   301 -ENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIG-------------------DY--SLEAV 343
             |:||:...||..           ||.|.|.|.|:.|                   ||  :...:
plant   493 KEHPDDILAIENN-----------RVKGYLKVTRAFGAGFLKQPKWNEALLEMFRIDYVGTSPYI 546

  Fly   344 IAEPDFVDVQLNEAHDFLVLGTDGLWDHVP-ESLIIETVYDSLADTTMKLDD----IPKLLIEAA 403
            ...|.....:|:....||:|.:|||:::.. |..|.|.  ||......:.|.    |.::|:.||
plant   547 TCSPSLHHHRLSSRDKFLILSSDGLYEYFSNEEAIFEV--DSFISAFPEGDPAQHLIQEVLLRAA 609

  Fly   404 KE----------------RDSQDNITAVVVLLKPR 422
            |:                |...|:::.:|:.|:.|
plant   610 KKYGMDFHELLEIPQGDRRRYHDDVSVIVISLEGR 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 63/357 (18%)
PLL3NP_187551.1 PP2Cc 253..641 CDD:238083 77/420 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.