DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G06270

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_187278.2 Gene:AT3G06270 / 819801 AraportID:AT3G06270 Length:348 Species:Arabidopsis thaliana


Alignment Length:349 Identity:88/349 - (25%)
Similarity:147/349 - (42%) Gaps:89/349 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 CEC----------HQQKEPLHTSAAVKNKPRK-MEDRCVCLDRFGEMYELL----------DK-- 191
            |:|          ...:.||..:..:|.|.:| :....|....|..:|.:|          ||  
plant     6 CKCCSRYPSSSSDGDSRGPLEANGVLKGKDQKPLGSIHVPSPNFDMVYSVLSQRGYYPDSPDKEN 70

  Fly   192 --------------TTRFFGVFDGHS--GSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNA 240
                          ...||||||||.  |:..:.:...::.::|::......||        ..|
plant    71 QDTYCIKTELQGNPNVHFFGVFDGHGVLGTQCSNFVKERVVEMLSEDPTLLEDP--------EKA 127

  Fly   241 FESAFLLADERFTQKKI---TSGTTSVCALITKDQLYIAWVGDSKALLVGK-RTQL---QLVKPH 298
            ::||||..:|.....:|   .||||::..|:..|::|:|.||||:|:|..| |.::   .|....
plant   128 YKSAFLRVNEELHDSEIDDSMSGTTAITVLVVGDKIYVANVGDSRAVLAVKDRNRILAEDLSYDQ 192

  Fly   299 KPENPDERKRIETAGGTVL-------------------HAQG-----QWRVNGI---LNVARSIG 336
            .|...||.:|::..|..||                   .::|     .|..||:   ....||:|
plant   193 TPFRKDECERVKACGARVLSVDQVEGLKDPNIQTWANEESEGGDPPRLWVQNGMYPGTAFTRSVG 257

  Fly   337 DYSLEA--VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETV---YDSLADTTMKLDDIP 396
            |::.|:  |||||:...|.|:..|.|.|:.:||:::.:|...:::.|   .|..........:..
plant   258 DFTAESIGVIAEPEVSMVHLSPNHLFFVVASDGIFEFLPSQAVVDMVGRYADPRDGCAAAAAESY 322

  Fly   397 KLLIEAAKERDSQDNITAVVVLLK 420
            ||.:|   ..:..|:||.::|.:|
plant   323 KLWLE---HENRTDDITIIIVQIK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 83/326 (25%)
AT3G06270NP_187278.2 PP2Cc 68..342 CDD:238083 75/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13832
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.