DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT3G05640

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001326841.1 Gene:AT3G05640 / 819731 AraportID:AT3G05640 Length:358 Species:Arabidopsis thaliana


Alignment Length:344 Identity:83/344 - (24%)
Similarity:143/344 - (41%) Gaps:66/344 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YILKLTDNSEVDRLKDFADEAAPENCECHQQKEPLHTSAAVKNK----------PRKME-----D 174
            :.:|...|  ::..|.:|.||..|.....::||.:..|:...|.          .|:.|     |
plant    15 FSIKKAKN--INSSKSYAKEATDEMAREAKKKELILRSSGCINADGSNNLASVFSRRGEKGVNQD 77

  Fly   175 RCVCLDRFGEMYELLDKTTRFFGVFDGHS--GSLSATYATSQLP--------QLLADQLKANPDP 229
            ..:..:.:|...:::     |.|:||||.  |...:....:.:|        :.|:....|.||.
plant    78 CAIVWEGYGCQEDMI-----FCGIFDGHGPWGHFVSKQVRNSMPISLLCNWKETLSQTTIAEPDK 137

  Fly   230 -----AAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALITKDQLYIAWVGDSKALLV--- 286
                 |.:...|.:.. |:..|..:.........||||::..:...|.:|||.||||:|:|.   
plant   138 ELQRFAIWKYSFLKTC-EAVDLELEHHRKIDSFNSGTTALTIVRQGDVIYIANVGDSRAVLATVS 201

  Fly   287 --GKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGI---------LNVARSIGDYSL 340
              |....:||....||..|.|.:||....|.|...|.:..|:.:         |.::|:.|||.:
plant   202 DEGSLVAVQLTVDFKPNLPQEEERIIGCNGRVFCLQDEPGVHRVWQPVDESPGLAMSRAFGDYCI 266

  Fly   341 E--AVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAA 403
            :  .:::.|:.....::....|::|.|||:||.:.....|:.|     .:|.:.....|.|::.|
plant   267 KDYGLVSVPEVTQRHISIRDQFIILATDGVWDVISNQEAIDIV-----SSTAERAKAAKRLVQQA 326

  Fly   404 ------KERD-SQDNITAV 415
                  |.|. :.|:|:||
plant   327 VRAWNRKRRGIAMDDISAV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 74/309 (24%)
AT3G05640NP_001326841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.