DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PP2C5

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_181547.1 Gene:PP2C5 / 818609 AraportID:AT2G40180 Length:390 Species:Arabidopsis thaliana


Alignment Length:341 Identity:102/341 - (29%)
Similarity:152/341 - (44%) Gaps:40/341 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PPQYDLL-------KLQKFVASEFEKYI-------LKLTDNSEVDRLKDFADEAAPENCECHQQK 156
            ||:..::       |..|...|:.|..:       |.||....|........|.|.:..|..:.:
plant    60 PPKLTMVACPPRKPKETKTTGSDSETVLKRKRPPMLDLTAAPTVASWCSTTRETAEKGAEVVEAE 124

  Fly   157 EPLHTSAAVKNKPR-KMEDRCVCLDRFGEMYELLDKT------TRFFGVFDGHSGSLSATYATSQ 214
            |..:.|...|...| .||||         .:..:|:.      ..||||||||.||.:|.:|...
plant   125 EDGYYSVYCKRGRRGPMEDR---------YFAAVDRNDDGGYKNAFFGVFDGHGGSKAAEFAAMN 180

  Fly   215 LPQLLADQLKANPDPAAFSPD--FYRNAFESAFLLADERFTQKKITSGTTSVCALITKDQLYIAW 277
                |.:.::|....|....|  ...:|....::..||.|.::....|...|.|||:|.:|.::.
plant   181 ----LGNNIEAAMASARSGEDGCSMESAIREGYIKTDEDFLKEGSRGGACCVTALISKGELAVSN 241

  Fly   278 VGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGD-YSLE 341
            .||.:|::....|...|...|.|...:|.||||..||.|....|.||:.|.|.|:|.||| |..|
plant   242 AGDCRAVMSRGGTAEALTSDHNPSQANELKRIEALGGYVDCCNGVWRIQGTLAVSRGIGDRYLKE 306

  Fly   342 AVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETV--YDSLADTTMKLDDIPKLLIEAAK 404
            .|||||:...:::....:||:|.:|||||.|.....::.|  |....:..|.|....| |.|.:.
plant   307 WVIAEPETRTLRIKPEFEFLILASDGLWDKVTNQEAVDVVRPYCVGVENPMTLSACKK-LAELSV 370

  Fly   405 ERDSQDNITAVVVLLK 420
            :|.|.|:|:.:::.|:
plant   371 KRGSLDDISLIIIQLQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 87/270 (32%)
PP2C5NP_181547.1 PP2Cc 128..385 CDD:238083 87/270 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.