DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PLL1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_181078.2 Gene:PLL1 / 818102 AraportID:AT2G35350 Length:783 Species:Arabidopsis thaliana


Alignment Length:496 Identity:101/496 - (20%)
Similarity:155/496 - (31%) Gaps:205/496 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GP--PQYDLLKLQKFVASEFEKYILKL-------TDNS--EVDRLKDFAD---EAAPENCECHQQ 155
            ||  |::.:..|.:.|.||.:....:|       ||.|  |:::..:|.|   |.|..:|...::
plant   299 GPDAPEFLMANLYRAVHSELQGLFWELEEEDDNPTDISTRELEQQGEFEDHVNEMASSSCPATEK 363

  Fly   156 KEP-----LHTS-AAVKNKPRKMEDRCVCLDRFGEMYELLDK-----------TTRF-FGVFD-- 200
            :|.     |.:| ..|:.|.||            .::|||.:           :.|| |.|.|  
plant   364 EEEEMGKRLTSSLEVVEVKERK------------RLWELLAEAQAEDALDLSGSDRFAFSVDDAI 416

  Fly   201 --GHSGSLSAT--YATSQLPQLLADQ--------------------------------------- 222
              |::.|:.:.  ...|:|.|.|:.|                                       
plant   417 GAGNAVSVGSKRWLLLSKLKQGLSKQGISGRKLFPWKSGVEENETEEVDNVGVEEGVDKRRKRRK 481

  Fly   223 ---------LKANPDPAAFSPDFYRNAFESAFLLADERFTQKKITS-------GTTSVCALITKD 271
                     |||..:..        .|.|.|||    ..|.|.:.:       |:..:.||:..|
plant   482 AGTVDHELVLKAMSNGL--------EATEQAFL----EMTDKVLETNPELALMGSCLLVALMRDD 534

  Fly   272 QLYIAWVGDSKALLV-------------------------------------------------- 286
            .:||..:|||:||:.                                                  
plant   535 DVYIMNIGDSRALVAQYQVEETGESVETAERVEERRNDLDRDDGNKEPLVVDSSDSTVNNEAPLP 599

  Fly   287 -GKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIG----------DYSL 340
             .|...|||...|.....||..||:.......|.....||.|.|.|.|:.|          |..|
plant   600 QTKLVALQLTTDHSTSIEDEVTRIKNEHPDDNHCIVNDRVKGRLKVTRAFGAGFLKQPKLNDALL 664

  Fly   341 EA-----------VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDD 394
            |.           :...|.....:|.|...|:||.:|||:.::....::....:...|.......
plant   665 EMFRNEYIGTDPYISCTPSLRHYRLTENDQFMVLSSDGLYQYLSNVEVVSLAMEKFPDGDPAQHV 729

  Fly   395 IPKLLIEAAKE----------------RDSQDNITAVVVLL 419
            |.:||:.|||:                |...|:.|.:|:.|
plant   730 IQELLVRAAKKAGMDFHELLDIPQGDRRKYHDDCTVLVIAL 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 81/420 (19%)
PLL1NP_181078.2 PP2Cc <484..770 CDD:238083 61/297 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.