DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT2G34740

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_181021.4 Gene:AT2G34740 / 818039 AraportID:AT2G34740 Length:339 Species:Arabidopsis thaliana


Alignment Length:362 Identity:99/362 - (27%)
Similarity:167/362 - (46%) Gaps:56/362 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KLLHRSTQQLEQDLCFA-----------KECEVTVEGPPQYDLLKLQKFVASEFEKYILKLTDNS 133
            |.:..||.:.|..|..|           |......||.   |.|::::.:  ..:..::.:.|..
plant     3 KTIKNSTHRPEDILVHAIKKRRSASGDVKNAVKLKEGE---DYLRVEEEI--PHDDNVVVIDDGC 62

  Fly   134 EVDRLKDFADEAAPENCE-CHQQKEPLHTSAAVKNK-PRKMEDRCVCLDRFGEMYELLDKTTRFF 196
            :.|...|..|:...||.. |.::.:  |....||.: ...|||..|...:..:.:.|     ..:
plant    63 DHDHDVDDNDDDEEENGRYCRREFD--HGYHLVKGQMGHGMEDFIVADTKTVKGHNL-----GLY 120

  Fly   197 GVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRN---AFESAFLLADERFTQKKI- 257
            .:|||||||..|.|..:.|...:..|           |||:||   |.:.|:...|:...|..: 
plant   121 AIFDGHSGSDVADYLQNHLFDNILSQ-----------PDFWRNPKKAIKRAYKSTDDYILQNVVG 174

  Fly   258 -TSGTTSVCAL-ITKDQLYIAWVGDSKALLVGKRTQL-QLVKPHKPENPDERKRIETAGGTVLHA 319
             ..|:|:|.|: |...::.:|.||||:|:|..:...: |:...|:|:.  ||..:::.||.|...
plant   175 PRGGSTAVTAIVIDGKKIVVANVGDSRAILCRESDVVKQITVDHEPDK--ERDLVKSKGGFVSQK 237

  Fly   320 QGQW-RVNGILNVARSIGDYSLEAVIAEPDFVDVQLNEAHD---FLVLGTDGLWDHVPESLIIET 380
            .|.. ||:|.|.:.|:.||..|:..|:.  ..::::.|.||   ||:|.:||||    :.:..:.
plant   238 PGNVPRVDGQLAMTRAFGDGGLKEHISV--IPNIEIAEIHDDTKFLILASDGLW----KVMSNDE 296

  Fly   381 VYDSLADTTMKLDDIPKLLIEAAKERDSQDNITAVVV 417
            |:|.:.... ..::..|:||:.|..|.|:|:|:.|||
plant   297 VWDQIKKRG-NAEEAAKMLIDKALARGSKDDISCVVV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 81/270 (30%)
AT2G34740NP_181021.4 PP2Cc 86..334 CDD:238083 81/274 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.