DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PP2CG1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_180926.1 Gene:PP2CG1 / 817935 AraportID:AT2G33700 Length:380 Species:Arabidopsis thaliana


Alignment Length:319 Identity:93/319 - (29%)
Similarity:156/319 - (48%) Gaps:51/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LKLTDNSEVD----RLKDFADEAAPENCECHQQKEPLHTSAAVKNKPRK--MEDRCVCLD----R 181
            |:|..|::||    .:|...|::         :..|::.|.:...:..|  |||..:|:|    .
plant    55 LQLAANADVDVCNLVMKSLDDKS---------EFLPVYRSGSCAEQGAKQFMEDEHICIDDLVNH 110

  Fly   182 FGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFL 246
            .|...: ......|:||||||.|:.:|.:....:.:.:.:.       ::| |...:.|.:||||
plant   111 LGAAIQ-CSSLGAFYGVFDGHGGTDAAHFVRKNILRFIVED-------SSF-PLCVKKAIKSAFL 166

  Fly   247 LADERFTQKK---ITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKR 308
            .||..|....   |:||||::.|.|...:|.||..||.:|:|..:...::|.|.|||....|:.|
plant   167 KADYEFADDSSLDISSGTTALTAFIFGRRLIIANAGDCRAVLGRRGRAIELSKDHKPNCTAEKVR 231

  Fly   309 IETAGGTVLHAQGQWRVNGILNVARSIGDYSLEA-------VIAEPDFVDVQLNEAHDFLVLGTD 366
            ||..||.|....    :||.|:|||:|||:.::.       :..||:..:..|:|..:||::|.|
plant   232 IEKLGGVVYDGY----LNGQLSVARAIGDWHMKGPKGSACPLSPEPELQETDLSEDDEFLIMGCD 292

  Fly   367 GLWDHVPESLIIETVYDSLADTTMKLDDIP----KLLIEAAKERDSQDNITAVVVLLKP 421
            ||||.:.....:     ::|...:.:.:.|    :.|:..|.:|::.||:|.:||...|
plant   293 GLWDVMSSQCAV-----TIARKELMIHNDPERCSRELVREALKRNTCDNLTVIVVCFSP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 84/278 (30%)
PP2CG1NP_180926.1 PP2C_C 74..378 CDD:421906 87/300 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.