DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PBCP

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_565696.1 Gene:PBCP / 817569 AraportID:AT2G30170 Length:298 Species:Arabidopsis thaliana


Alignment Length:296 Identity:68/296 - (22%)
Similarity:109/296 - (36%) Gaps:96/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DFADEAAPENCECHQQKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFF-------- 196
            ||....||.  |....:..|..|..:...|.  .|:   :::.||        ..||        
plant    28 DFLCRCAPS--EIQPLRPELSLSVGIHAIPH--PDK---VEKGGE--------DAFFVSSYRGGV 77

  Fly   197 -GVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNA----------FESAFLLADE 250
             .|.||.||              .|:|   :.||:.||.:...||          ::..||: |:
plant    78 MAVADGVSG--------------WAEQ---DVDPSLFSKELMANASRLVDDQEVRYDPGFLI-DK 124

  Fly   251 RFTQKKITSGTTSVCALITK-DQLYIAWVGDS--KALLVGKRTQLQLVKPHKPENPDERKRIETA 312
            ..|........|.:.|::.: ..|.|..|||.  |.|..|:.......:.|..:.|.:       
plant   125 AHTATTSRGSATIILAMLEEVGILKIGNVGDCGLKLLREGQIIFATAPQEHYFDCPYQ------- 182

  Fly   313 GGTVLHAQGQWRVNGILNVARSIGDYSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHV--PES 375
                |.::|.         |::..|.|.       ..|:||..   |.:|:|:|||:|:|  .|.
plant   183 ----LSSEGS---------AQTYLDASF-------SIVEVQKG---DVIVMGSDGLFDNVFDHEI 224

  Fly   376 LIIETVYDSLADTTMKLDDIPKLLIEAAK--ERDSQ 409
            :.|.|.:..:|:::       :||.|.|.  .||::
plant   225 VSIVTKHTDVAESS-------RLLAEVASSHSRDTE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 62/276 (22%)
PBCPNP_565696.1 PP2Cc 39..251 CDD:214625 61/279 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.