DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT2G30020

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_180563.1 Gene:AT2G30020 / 817553 AraportID:AT2G30020 Length:396 Species:Arabidopsis thaliana


Alignment Length:288 Identity:86/288 - (29%)
Similarity:140/288 - (48%) Gaps:34/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PLHTSAAVKNKPRKMEDRCVCLDRFGEMYELL---------------------DKTTRFFGVFDG 201
            |:.:||||...||   :.|..::|.|:.|.:.                     |:....|||:||
plant   115 PISSSAAVAATPR---EECREVEREGDGYSVYCKRGRREAMEDRFSAITNLHGDRKQAIFGVYDG 176

  Fly   202 HSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQKK-ITSGTTSVC 265
            |.|..:|.:|...|.:.:.:::....|.:..:     .|.:..:|..|..|.::: :..|:..|.
plant   177 HGGVKAAEFAAKNLDKNIVEEVVGKRDESEIA-----EAVKHGYLATDASFLKEEDVKGGSCCVT 236

  Fly   266 ALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILN 330
            ||:.:..|.::..||.:|::........|...|:|...||||||||.||.|....|.||:.|.|.
plant   237 ALVNEGNLVVSNAGDCRAVMSVGGVAKALSSDHRPSRDDERKRIETTGGYVDTFHGVWRIQGSLA 301

  Fly   331 VARSIGDYSLEA-VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMK--L 392
            |:|.|||..|:. |||||:....::...|:||:|.:|||||.|.....:: :...|...|.|  |
plant   302 VSRGIGDAQLKKWVIAEPETKISRIEHDHEFLILASDGLWDKVSNQEAVD-IARPLCLGTEKPLL 365

  Fly   393 DDIPKLLIEAAKERDSQDNITAVVVLLK 420
            ....|.|::.:..|.|.|:|:.:::.|:
plant   366 LAACKKLVDLSASRGSSDDISVMLIPLR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 84/283 (30%)
AT2G30020NP_180563.1 PP2Cc 139..392 CDD:238083 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.