DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and DBP1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001324148.1 Gene:DBP1 / 817102 AraportID:AT2G25620 Length:392 Species:Arabidopsis thaliana


Alignment Length:274 Identity:89/274 - (32%)
Similarity:140/274 - (51%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 MEDRCVCLDRFGEMYELLDK---TTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFS 233
            |||..:|:|.|.:.:.||:.   .:.|:||||||.|..:|.:|...:|:.:.:..:        .
plant   102 MEDAYLCVDNFMDSFGLLNSEAGPSAFYGVFDGHGGKHAAEFACHHIPRYIVEDQE--------F 158

  Fly   234 PDFYRNAFESAFLLADERFTQK-----KITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQ 293
            |........||||..|..|.:.     .:.||||::.|::....|.:|..||.:|:|..:...::
plant   159 PSEINKVLSSAFLQTDTAFLEACSLDGSLASGTTALAAILFGRSLVVANAGDCRAVLSRQGKAIE 223

  Fly   294 LVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEA------------VIAE 346
            :.:.|||.:..||:|||.:||.|....    :||.|||||::||:.:|.            :|||
plant   224 MSRDHKPMSSKERRRIEASGGHVFDGY----LNGQLNVARALGDFHMEGMKKKKDGSDCGPLIAE 284

  Fly   347 PDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLA---DTTMKLDDIPKLLIEAAKERDS 408
            |:.:..:|.|..:||::|.||:||.......::.....|.   |..|    ..|.|:|.|.:|.|
plant   285 PELMTTKLTEEDEFLIIGCDGVWDVFMSQNAVDFARRRLQEHNDPVM----CSKELVEEALKRKS 345

  Fly   409 QDNITAVVVLLKPR 422
            .||:|||||.|:|:
plant   346 ADNVTAVVVCLQPQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 87/269 (32%)
DBP1NP_001324148.1 PLN03145 3..392 CDD:215603 89/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.