DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT2G25070

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001324497.1 Gene:AT2G25070 / 817045 AraportID:AT2G25070 Length:355 Species:Arabidopsis thaliana


Alignment Length:359 Identity:88/359 - (24%)
Similarity:143/359 - (39%) Gaps:106/359 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KLTDNSEVDRLKDFADEAAPENCECHQQKEPLHTSAAVKNKPRKMED-RCVCLDRFGEMYELLDK 191
            ||:::.|.|:|:                    ...::::.....||| ....||        ||.
plant    12 KLSEDGENDKLR--------------------FGLSSMQGWRATMEDAHAAILD--------LDD 48

  Fly   192 TTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQKK 256
            .|.||||:|||.|.:.|.:....|.|    |:.:|   .|:.......:...||...|:....::
plant    49 KTSFFGVYDGHGGKVVAKFCAKYLHQ----QVISN---EAYKTGDVETSLRRAFFRMDDMMQGQR 106

  Fly   257 --------------------------------------------------ITSGTTSVCALITKD 271
                                                              .|||.|:..|||...
plant   107 GWRELAVLGDKMNKFSGMIEGFIWSPRSGDTNNQPDSWPLEDGPHSDFTGPTSGCTACVALIKDK 171

  Fly   272 QLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIG 336
            :|::|..|||:.::..|.....|.|.|||:...|::||..||| .:||   .|:||.||:.|:||
plant   172 KLFVANAGDSRCVISRKSQAYNLSKDHKPDLEVEKERILKAGG-FIHA---GRINGSLNLTRAIG 232

  Fly   337 DYSL----------EAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMK 391
            |...          :.|.|:||...:.|.:..||||:..||:||.:....:::.:::.|...| |
plant   233 DMEFKQNKFLPSEKQMVTADPDINTIDLCDDDDFLVVACDGIWDCMSSQELVDFIHEQLKSET-K 296

  Fly   392 LDDIPKLLIEAAKERDSQ-----DNITAVVVLLK 420
            |..:.:.:::.....|:.     ||:|.::|..|
plant   297 LSTVCEKVVDRCLAPDTATGEGCDNMTIILVQFK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 82/324 (25%)
AT2G25070NP_001324497.1 PP2Cc 14..327 CDD:214625 84/352 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13832
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.