DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PIA1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_973490.1 Gene:PIA1 / 816590 AraportID:AT2G20630 Length:290 Species:Arabidopsis thaliana


Alignment Length:275 Identity:82/275 - (29%)
Similarity:130/275 - (47%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KEPLHTSAAVKNKP-RKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATY-ATSQLPQL 218
            |...|....||.|. ..|||..|     .|..::.......|.:||||.|...|.| .|:....:
plant    28 KNIAHGYDFVKGKAGHPMEDYVV-----SEFKKVDGHDLGLFAIFDGHLGHDVAKYLQTNLFDNI 87

  Fly   219 LADQLKANPDPAAFSPDFY---RNAFESAFLLADERFTQKKI---TSGTTSVCA-LITKDQLYIA 276
            |.::            ||:   :||..:|::..|....::.:   ..|:|:|.. ||....|.||
plant    88 LKEK------------DFWTDTKNAIRNAYISTDAVILEQSLKLGKGGSTAVTGILIDGKTLVIA 140

  Fly   277 WVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQW-RVNGILNVARSIGDYSL 340
            .||||:|::.......||...|:|..  |:|.||:.||.|.:..|.. ||:|.|.|||:.||.||
plant   141 NVGDSRAVMSKNGVASQLSVDHEPSK--EQKEIESRGGFVSNIPGDVPRVDGQLAVARAFGDKSL 203

  Fly   341 EA-VIAEPDFVDVQLNEAHDFLVLGTDGLWDHV--PESL-IIETVYDSLADTTMKLDDIPKLLIE 401
            :. :.::||..|..::...:|::..:||:|..:  .|:: :|:::.|..|        ..|.|||
plant   204 KIHLSSDPDIRDENIDHETEFILFASDGVWKVMSNQEAVDLIKSIKDPQA--------AAKELIE 260

  Fly   402 AAKERDSQDNITAVV 416
            .|..:.|.|:|:.:|
plant   261 EAVSKQSTDDISCIV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 81/271 (30%)
PIA1NP_973490.1 PP2Cc 43..278 CDD:238083 77/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.