DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ILKAP

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_110395.1 Gene:ILKAP / 80895 HGNCID:15566 Length:392 Species:Homo sapiens


Alignment Length:317 Identity:94/317 - (29%)
Similarity:133/317 - (41%) Gaps:69/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TSAAVKNKPRKMEDRCVC-------------LDRFGEMYELLDK-----------------TTR- 194
            ||...||...::.::.||             .:|.||..|:.|.                 .|| 
Human    81 TSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITEECRPPSSLITRV 145

  Fly   195 -FFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPD-FYRNAFESAFLLADERFTQKKI 257
             :|.|||||.|..::.:|...|.|.|   ::..|.....|.: ..:......|...||.|.::..
Human   146 SYFAVFDGHGGIRASKFAAQNLHQNL---IRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQAS 207

  Fly   258 T------SGTTSVCALITKDQLYIAWVGDSKALLV------GKRTQLQLVKPHKPENPDERKRIE 310
            :      .|:|:.|.|...:.||||.:|||:|:|.      .|...|.|.|.|.|...:||.||:
Human   208 SQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQ 272

  Fly   311 TAGGTVLHAQGQWRVNGILNVARSIGD--YSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWD-HV 372
            .|||.|...    ||.|:|.|:|||||  |....|.:.||....||.....|::|..|||:. ..
Human   273 KAGGNVRDG----RVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFT 333

  Fly   373 PE---SLIIETVYD---------SLADTTMKLDDIPKLLIEAAKERDSQDNITAVVV 417
            ||   :.|:..:.|         |.||.  :.:.....|...|.:|.|.||:|.:||
Human   334 PEEAVNFILSCLEDEKIQTREGKSAADA--RYEAACNRLANKAVQRGSADNVTVMVV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 94/317 (30%)
ILKAPNP_110395.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 4/8 (50%)
PP2Cc 108..390 CDD:238083 88/290 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.