DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1h

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001070923.1 Gene:ppm1h / 768291 ZFINID:ZDB-GENE-061027-190 Length:516 Species:Danio rerio


Alignment Length:424 Identity:84/424 - (19%)
Similarity:146/424 - (34%) Gaps:152/424 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DEAAPENCECHQQKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMY--ELLDKTTRFFGVFDGHSGS 205
            |:|..|..|.  :|.|...| :|...|.:........|....::  |:.:....::.:||||.||
Zfish    88 DQACCEVVEL--RKRPADPS-SVSYTPSRRRSSLPSGDVLDTIHNPEVKELDFHYWALFDGHGGS 149

  Fly   206 LSATYATSQLPQLLADQLK---------------------ANP---------------------- 227
            .:|.:|...|...:.:||:                     .||                      
Zfish   150 GAAVFAAKFLHLHIEEQLQEVLEILQDPGLQPPTCLGEESPNPQLHASASGSQRGLSRAASLRGA 214

  Fly   228 -----DPAAFSPDFYR-----------NAFESAFLLADERFTQKK----ITSGTTSVCALITKDQ 272
                 .|...:|.|:.           .|.|:||...|....:::    |:.|.|::..:....:
Zfish   215 AGAPGSPNTMAPRFFMEKKIKQESLVVGAIENAFKEMDAHIARERCAYSISGGCTALAVMFLLGK 279

  Fly   273 LYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIE--------------------------- 310
            ||:|..|||:||:|.....:.:.....||:  ||:|::                           
Zfish   280 LYVANAGDSRALIVRAGELITMSSSFTPES--ERQRLQFLAHLQPSLLGSDFTHLEFPRRVTKRE 342

  Fly   311 ----------TAGG-------------TVLHAQG-QWRVNGILNVARSIGDYSL---EAVIAEPD 348
                      |..|             .:::.:| :.||...:.:.|.:||:.|   ::.||...
Zfish   343 IGKRMLYRDFTMNGWAYKTVQEEDLKFPLIYGEGKKARVLATIGITRGLGDHDLKVHDSDIAIKP 407

  Fly   349 FV----DVQL-------NEAHDFLVLGTDGLWDHVPESLIIETVYDSLADT--------TMKLDD 394
            |:    :||:       :.|.|.|:|.||||||.:....:.:.|...|.:.        ||...|
Zfish   408 FLSCSPEVQVYNLCQFEHGADDVLILATDGLWDVLSNQEVADAVSGFLGNCDPDDQHRYTMAAQD 472

  Fly   395 IPKLLIEAAKER---------DSQDNITAVVVLL 419
            :........|:|         .|.|:|:..::.|
Zfish   473 LVMKARGILKDRGWRIAGDRLGSGDDISVFIIPL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 77/405 (19%)
ppm1hNP_001070923.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..122 3/20 (15%)
PP2Cc 127..506 CDD:238083 73/380 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..202 2/20 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577913
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.